NOX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69573

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NOX1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NOX1(NADPH oxidase 1) The peptide sequence was selected from the C terminal of human NOX1. Peptide sequence STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27175607 and 23688500). Rat reactivity reported in scientific literature (PMID: 22683600).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NOX1 Antibody - BSA Free

Western Blot: NOX1 Antibody [NBP1-69573]

Western Blot: NOX1 Antibody [NBP1-69573]

Western Blot: NOX1 Antibody [NBP1-69573] - NOX1 antibody - C-terminal region validated by WB using Epithelial Colorectal Adenocarcinoma CaCO2 at 1:10.
Western Blot: NOX1 Antibody [NBP1-69573]

Western Blot: NOX1 Antibody [NBP1-69573]

Western Blot: NOX1 Antibody [NBP1-69573] - This Anti-NOX1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.5ug/ml.

Applications for NOX1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Reported in scientific literature (PMID: 30096407)

Immunohistochemistry-Paraffin

Reported in scientific literature (PMID: 30096407)

Knockdown Validated

Reported in scientific literature (PMID: 30096407)

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NOX1

Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox.Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox. Three splice variants of NOX1 have been identified, NOH-1L, NOH-1S and NOH-1Lv. The NOH-1S currents were reversibly blocked by zinc, a known H+ channel inhibitor. The NOH-1S variant does not contain an electron transport chain and it is thought that H+ conductance is its main physiologic function, whereas NOH-1L may conduct H+ ions as part of its electron transport mechanism.

Long Name

NADPH Oxidase 1

Alternate Names

MOX-1, NOH1

Entrez Gene IDs

27035 (Human)

Gene Symbol

NOX1

UniProt

Q9Y5S8 (Human)

Additional NOX1 Products

Product Documents for NOX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NOX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Redox Enzymes

Citations for NOX1 Antibody - BSA Free

Customer Reviews for NOX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NOX1 Antibody - BSA Free and earn rewards!

Have you used NOX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies