NQO-1 Antibody (9M3H10)

Novus Biologicals | Catalog # NBP3-15793

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9M3H10 expressed in HEK293
View all NQO-1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NQO-1 (P15559). MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NQO-1 Antibody (9M3H10)

NQO-1 Antibody (1O2N3) NQO-1 Antibody (1O2N3)

NQO-1 Antibody (1O2N3) [NBP3-15793] - Analysis of extracts of various lysates, using NQO1 antibody at 1:20000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

NQO-1 Antibody (1O2N3) [NBP3-15793] - Analysis of extracts of various lysates, using NQO1 antibody at 1:20000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
NQO-1 Antibody (1O2N3) NQO-1 Antibody (1O2N3)

NQO-1 Antibody (1O2N3) [NBP3-15793] - Analysis of extracts from wild type(WT) and NQO1 knockdown (KD) HeLa cells, using NQO1 antibody at 1:20000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

NQO-1 Antibody (1O2N3) [NBP3-15793] - Analysis of extracts from wild type(WT) and NQO1 knockdown (KD) HeLa cells, using NQO1 antibody at 1:20000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
NQO-1 Antibody (9M3H10)

Immunocytochemistry/ Immunofluorescence: NQO-1 Antibody (9M3H10) [NQO-1] -

Immunocytochemistry/ Immunofluorescence: NQO-1 Antibody (9M3H10) [NQO-1] - Confocal imaging of paraffin-embedded Human stomach tissue using [KD Validated] NQO-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
NQO-1 Antibody (9M3H10)

Immunocytochemistry/ Immunofluorescence: NQO-1 Antibody (9M3H10) [NQO-1] -

Immunocytochemistry/ Immunofluorescence: NQO-1 Antibody (9M3H10) [NQO-1] - Confocal imaging of paraffin-embedded Rat stomach tissue using [KD Validated] NQO-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
NQO-1 Antibody (9M3H10)

Immunocytochemistry/ Immunofluorescence: NQO-1 Antibody (9M3H10) [NQO-1] -

Immunocytochemistry/ Immunofluorescence: NQO-1 Antibody (9M3H10) [NQO-1] - Confocal imaging of paraffin-embedded Mouse stomach tissue using [KD Validated] NQO-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Applications for NQO-1 Antibody (9M3H10)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:100 -1:500

Western Blot

1:5000 - 1:20000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NQO-1

NQO1 (NAD(P)H dehydrogenase [quinone] 1) is a 2-electron reductase that detoxifies quinones derived from the oxidation of phenolic metabolites of benzene. Individuals homozygous for the T/T form of the 609C-T polymorphism have an increased risk of benzene hematotoxicity.

Long Name

NAD(P)H Dehydrogenase, Quinone 1

Alternate Names

Azoreductase, DHQU, DIA4, Diaphorase-4, Dioxin-inducible 1, DTD, Menadione Reductase, NMOR1, NQO1, QR1, Quinone Reductase 1

Gene Symbol

NQO1

Additional NQO-1 Products

Product Documents for NQO-1 Antibody (9M3H10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NQO-1 Antibody (9M3H10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

p53 Pathway
Redox Enzymes

Customer Reviews for NQO-1 Antibody (9M3H10)

There are currently no reviews for this product. Be the first to review NQO-1 Antibody (9M3H10) and earn rewards!

Have you used NQO-1 Antibody (9M3H10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies