NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free

Novus Biologicals | Catalog # H00004891-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Porcine, Bovine

Cited:

Human, Bovine

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4C6

Format

Azide and BSA Free
View all NRAMP2/SLC11A2 Primary Antibodies »

Product Specifications

Immunogen

SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF

Reactivity Notes

Bovine reactivity reported in scientific literature (PMID: 19820055).

Specificity

SLC11A2 - solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free

Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01]

Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01]

NRAMP2-SLC11A2-DMT1-Antibody-4C6-Immunohistochemistry-Paraffin-H00004891-M01-img0009.jpg
Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01]

Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01]

Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Analysis of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml.
ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01]

ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01]

ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.
NRAMP2/SLC11A2/DMT1 Antibody (4C6)

Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] -

Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of iron handling proteins in healthy kidney. Representatives images of ZIP8 (a), ZIP14 (b), divalent metal transporter 1 (DMT1; c), L-ferritin (d), H-ferritin (e), & ferroportin (f) staining in healthy kidney. Renal structures indicated as glomerulus (g), proximal tubule (PT), distal tubule (DT). Scale bar 20 µM. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29921869), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NRAMP2/SLC11A2/DMT1 Antibody (4C6)

Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] -

Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of putative iron importers in chronic kidney disease. Representative images of ZIP8 (a–f), ZIP14 (g–l), & divalent metal transporter 1 (DMT1; m–r) staining in control (a,g,m), early diabetic nephropathy (DNE; b,h,n), advanced diabetic nephropathy (DNA; c,i,o), focal segmental glomerulosclerosis (FSGS; d,j,p), lupus nephritis (LN; e,k,q) & IgA nephropathy (IgAN; f,l,r). Intensity in proximal & distal tubules quantified (s). Dots represent all quantified images (5 images per biopsy). Renal structures indicated as glomerulus (G), proximal tubule (PT), distal tubule (DT). Scale bar 40 µM. **p < 0.01; ***p < 0.001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29921869), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1:100-1:2000
Application Notes
It has been used for IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 29921869).

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NRAMP2/SLC11A2

The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]

Long Name

Natural Resistance-associated Macrophage Protein 2

Alternate Names

DCT1, SLC11A2

Entrez Gene IDs

4891 (Human)

Gene Symbol

SLC11A2

OMIM

206 (Human)

UniProt

NP_000608 (Human)

Additional NRAMP2/SLC11A2 Products

Product Documents for NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free

Customer Reviews for NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free and earn rewards!

Have you used NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Do you have a primary anti-DMT1 antibody against mouse for Western Blot?

    A: We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an Innovators Reward Program.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies