NrCAM Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59501

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NrCAM Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NRCAM(neuronal cell adhesion molecule) The peptide sequence was selected from the N terminal of NRCAM. Peptide sequence NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP. The peptide sequence for this immunogen was taken from within the described region.

Marker

Neuronal Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NrCAM Antibody - BSA Free

Western Blot: NrCAM Antibody [NBP1-59501]

Western Blot: NrCAM Antibody [NBP1-59501]

Western Blot: NrCAM Antibody [NBP1-59501] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml
Immunohistochemistry-Paraffin: NrCAM Antibody [NBP1-59501]

Immunohistochemistry-Paraffin: NrCAM Antibody [NBP1-59501]

Immunohistochemistry-Paraffin: NrCAM Antibody [NBP1-59501] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Applications for NrCAM Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NrCAM

Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. This gene is also expressed in non-neural tissues and may play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of this gene have been associated with autism and addiction vulnerability. Alternative splicing results in multiple transcript variants encoding different isoforms.

Long Name

Neuronal Cell Adhesion Molecule

Alternate Names

Bravo

Gene Symbol

NRCAM

UniProt

Q92823 (Human)

Additional NrCAM Products

Product Documents for NrCAM Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NrCAM Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Immunoglobulin Superfamily CAMs

Customer Reviews for NrCAM Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NrCAM Antibody - BSA Free and earn rewards!

Have you used NrCAM Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NrCAM Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All

  • Q: I have purchased the anti-NRCAM antibody (NBP1-59501) from your company. I have seen the reconstruction instruction about the antibody, and I have a question. As you have described that the Buffer is PBS and 2% Sucrose, I did not find sodium azide ect whi

    A: For our product NBP1-59501, we do not add any preservative to the buffer prior to lyophilization. If you would like, for extended storage, you can add some sodium azide to the reconstituted antibody to prevent contamination. We would recommend adding between 0.05-0.1%.

  • Q: It is stated that the addition of 50% glycerol is optional for storing. Does this mean that 50% is the final concentration or we need to add 50% volume of the original volume?

    A: For the glycerol, this is just an optional step. We recommend adding glycerol to the full sized vial to avoid freeze thaw cycles, otherwise you can aliquot the reconstituted antibody into working units and store without the glycerol. If you do decide to add glycerol to your vial, I would recommend adding up to 50% of the total antibody volume (50ul). You can add less if desired.

  • Q: I have purchased the anti-NRCAM antibody (NBP1-59501) from your company. I have seen the reconstruction instruction about the antibody, and I have a question. As you have described that the Buffer is PBS and 2% Sucrose, I did not find sodium azide ect whi

    A: For our product NBP1-59501, we do not add any preservative to the buffer prior to lyophilization. If you would like, for extended storage, you can add some sodium azide to the reconstituted antibody to prevent contamination. We would recommend adding between 0.05-0.1%.

  • Q: It is stated that the addition of 50% glycerol is optional for storing. Does this mean that 50% is the final concentration or we need to add 50% volume of the original volume?

    A: For the glycerol, this is just an optional step. We recommend adding glycerol to the full sized vial to avoid freeze thaw cycles, otherwise you can aliquot the reconstituted antibody into working units and store without the glycerol. If you do decide to add glycerol to your vial, I would recommend adding up to 50% of the total antibody volume (50ul). You can add less if desired.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies