NSP 5 alpha 3 alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85353

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DTEPMIRALEEKNKNFQKELSDLEEENRVLKEKLIYLEHSPNSEGAASHTGDSSCPTSITQESSFGSPTGNQMSSD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NSP 5 alpha 3 alpha Antibody - BSA Free

Western Blot: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Western Blot: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Western Blot: NSP 5 alpha 3 alpha Antibody [NBP1-85353] - Analysis in human cell line EFO-21.
Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353] - Staining of human endometrium.
Western Blot: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Western Blot: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Western Blot: NSP 5 alpha 3 alpha Antibody [NBP1-85353] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353] - Staining of human colon, endometrium, liver and testis using Anti-SPECC1 antibody NBP1-85353 (A) shows similar protein distribution across tissues to independent antibody NBP1-85352 (B).
Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353] - Staining of human testis.
Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353] - Staining of human colon.
Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353]

Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353] - Staining of human liver.

Applications for NSP 5 alpha 3 alpha Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NSP 5 alpha 3 alpha

NSP 5alpha 3alpha is a novel structure protein with potential roles in ribosome biogenesis and rRNA metabolism/processing. NSP5a3a is highly expressed in certain tumor cell lines, and may serve as a good tumor marker. In these cancer lines, NSP5a3a has been shown to interact with the nucleolar apoptosis protein B23 and may be involved in a novel p73 dependent apoptosis mechanism. Therefore, NSP5a3a is expected to become an important potential target for future cancer treatment research.

Alternate Names

cytospin-B, CYTSBcytospin B, FLJ36955, HCMOGT-1, NSP, NSP5, Nuclear structure protein 5, sperm antigen HCMOGT 1, Sperm antigen HCMOGT-1, sperm antigen with calponin homology and coiled coil domains 1, sperm antigen with calponin homology and coiled-coil domains 1cytokinesis and spindle organization B, sperm antigen with calponin-like and coiled coil domains 1, structure protein NSP5a3a, structure protein NSP5a3b, structure protein NSP5b3a, structure protein NSP5b3b

Gene Symbol

SPECC1

Additional NSP 5 alpha 3 alpha Products

Product Documents for NSP 5 alpha 3 alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NSP 5 alpha 3 alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NSP 5 alpha 3 alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NSP 5 alpha 3 alpha Antibody - BSA Free and earn rewards!

Have you used NSP 5 alpha 3 alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...