NSUN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94855

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 617-708 of human NSUN2 (NP_060225.4). SRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEPDSANPDALQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NSUN2 Antibody - BSA Free

Western Blot: NSUN2 AntibodyBSA Free [NBP2-94855]

Western Blot: NSUN2 AntibodyBSA Free [NBP2-94855]

Western Blot: NSUN2 Antibody [NBP2-94855] - Analysis of extracts of various cell lines, using NSUN2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: NSUN2 Antibody - BSA Free [NBP2-94855]

Immunocytochemistry/ Immunofluorescence: NSUN2 Antibody - BSA Free [NBP2-94855]

Immunocytochemistry/Immunofluorescence: NSUN2 Antibody [NBP2-94855] - Analysis of U2OS cells using NSUN2 at dilution of 1:100. Blue: DAPI for nuclear staining.
NSUN2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NSUN2 Antibody - BSA Free [NSUN2] -

Immunocytochemistry/ Immunofluorescence: NSUN2 Antibody - BSA Free [NSUN2] - Immunofluorescence analysis of HeLa cells using NSUN2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for NSUN2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NSUN2

Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 encodes a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA) (Brzezicha et al., 2006 [PubMed 17071714]).[supplied by OMIM].

Alternate Names

EC 2.1.1, EC 2.1.1.29, FLJ20303,5-methycytoisine methyltransferase, hTrm4, member 2, Myc-induced SUN-domain-containing protein, NOL1/NOP2/Sun domain family 2, NOL1/NOP2/Sun domain family member 2, NOP2/Sun domain family, member 2, SAKIMisu, Substrate of AIM1/Aurora kinase B, TRM4MISU, tRNA (cytosine-5-)-methyltransferase, tRNA (cytosine-5-)-methyltransferase NSUN2, tRNA methyltransferase 4 homolog

Gene Symbol

NSUN2

Additional NSUN2 Products

Product Documents for NSUN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NSUN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NSUN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NSUN2 Antibody - BSA Free and earn rewards!

Have you used NSUN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...