Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82580

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Nuclear Factor Erythroid Derived 2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining in human bone marrow and liver tissues. Corresponding NFE2 RNA-seq data are presented for the same tissues.
Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in control (vector only transfected HEK293T lysate) and NFE2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in human cell line HEL.
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human bone marrow shows moderate to strong nuclear positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Simple Western lane view shows a specific band for NFE2 in 0.2 mg/ml of K-562 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]

Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Electropherogram image(s) of corresponding Simple Western lane view. Nuclear Factor Erythroid Derived 2 antibody was used at 1:20 dilution on K-562 lysate(s).
Nuclear Factor Erythroid Derived 2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: Nuclear Factor Erythroid Derived 2 Antibody - BSA Free [NBP1-82580]

Chromatin Immunoprecipitation-exo-Seq: Nuclear Factor Erythroid Derived 2 Antibody - BSA Free [NBP1-82580]

ChIP-Exo-Seq composite graph for Anti-NFE2 (NBP1-82580) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. br/>In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in K-562, separated by Size, antibody dilution of 1:20, apparent MW was 52 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nuclear Factor Erythroid Derived 2

Alternate Names

Leucine zipper protein NF-E2, NF-E2, nuclear factor (erythroid-derived 2), 45kD, nuclear factor (erythroid-derived 2), 45kDa, Nuclear factor, erythroid-derived 2 45 kDa subunit, p45, p45 NF-E2, transcription factor NF-E2 45 kDa subunit

Gene Symbol

NFE2

Additional Nuclear Factor Erythroid Derived 2 Products

Product Documents for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

Customer Reviews for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nuclear Factor Erythroid Derived 2 Antibody - BSA Free and earn rewards!

Have you used Nuclear Factor Erythroid Derived 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies