Nuclear Factor Erythroid Derived 2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82580
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western, Chromatin Immunoprecipitation-exo-Seq
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free
Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]
Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in control (vector only transfected HEK293T lysate) and NFE2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]
Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in human cell line HEL.Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human bone marrow shows moderate to strong nuclear positivity in hematopoietic cells.Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]
Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Simple Western lane view shows a specific band for NFE2 in 0.2 mg/ml of K-562 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580]
Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Electropherogram image(s) of corresponding Simple Western lane view. Nuclear Factor Erythroid Derived 2 antibody was used at 1:20 dilution on K-562 lysate(s).Chromatin Immunoprecipitation-exo-Seq: Nuclear Factor Erythroid Derived 2 Antibody - BSA Free [NBP1-82580]
ChIP-Exo-Seq composite graph for Anti-NFE2 (NBP1-82580) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.Applications for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free
Application
Recommended Usage
Chromatin Immunoprecipitation-exo-Seq
1-10ug per reaction
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Simple Western
1:20
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. br/>In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in K-562, separated by Size, antibody dilution of 1:20, apparent MW was 52 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
See Simple Western Antibody Database for Simple Western validation: Tested in K-562, separated by Size, antibody dilution of 1:20, apparent MW was 52 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Nuclear Factor Erythroid Derived 2
Alternate Names
Leucine zipper protein NF-E2, NF-E2, nuclear factor (erythroid-derived 2), 45kD, nuclear factor (erythroid-derived 2), 45kDa, Nuclear factor, erythroid-derived 2 45 kDa subunit, p45, p45 NF-E2, transcription factor NF-E2 45 kDa subunit
Gene Symbol
NFE2
Additional Nuclear Factor Erythroid Derived 2 Products
Product Documents for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free
Customer Reviews for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Nuclear Factor Erythroid Derived 2 Antibody - BSA Free and earn rewards!
Have you used Nuclear Factor Erythroid Derived 2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...