NUP43 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88792

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NUP43 Antibody - BSA Free

Western Blot: NUP43 Antibody [NBP1-88792]

Western Blot: NUP43 Antibody [NBP1-88792]

Western Blot: NUP43 Antibody [NBP1-88792] - Analysis using Anti-NUP43 antibody NBP1-88792 (A) shows similar pattern to independent antibody NBP1-88793 (B).
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human colon.
Western Blot: NUP43 Antibody [NBP1-88792]

Western Blot: NUP43 Antibody [NBP1-88792]

Western Blot: NUP43 Antibody [NBP1-88792] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human cerebral cortex shows cytoplasmic and nuclear positivity in neuronal cells and glial cells.
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human adrenal gland, colon, kidney and testis using Anti-NUP43 antibody NBP1-88792 (A) shows similar protein distribution across tissues to independent antibody NBP1-88793 (B).
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human testis.
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human adrenal gland.
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792]

Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88792] - Staining of human kidney.

Applications for NUP43 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUP43

Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM]

Alternate Names

bA350J20.1, FLJ13287, nucleoporin 43kDa, nucleoporin Nup43, Nup107-160 subcomplex subunit Nup43, p42

Gene Symbol

NUP43

Additional NUP43 Products

Product Documents for NUP43 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NUP43 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUP43 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUP43 Antibody - BSA Free and earn rewards!

Have you used NUP43 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...