NXT2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93010

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all NXT2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 110-180 of human NXT2 (NP_061168.2). GLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NXT2 Antibody - Azide and BSA Free

Western Blot: NXT2 AntibodyAzide and BSA Free [NBP2-93010]

Western Blot: NXT2 AntibodyAzide and BSA Free [NBP2-93010]

Western Blot: NXT2 Antibody [NBP2-93010] - Analysis of extracts of various cell lines, using NXT2.Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: NXT2 Antibody - Azide and BSA Free [NBP2-93010]

Immunocytochemistry/ Immunofluorescence: NXT2 Antibody - Azide and BSA Free [NBP2-93010]

Immunocytochemistry/Immunofluorescence: NXT2 Antibody [NBP2-93010] - Analysis of U-2 OS cells using NXT2 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: NXT2 Antibody - Azide and BSA Free [NBP2-93010]

Immunocytochemistry/ Immunofluorescence: NXT2 Antibody - Azide and BSA Free [NBP2-93010]

Immunocytochemistry/Immunofluorescence: NXT2 Antibody [NBP2-93010] - Analysis of L929 cells using NXT2 at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for NXT2 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NXT2

Regulator of protein export for NES-containing proteins. Also plays a role in mRNA nuclear export

Alternate Names

BM-025, NTF2-related export protein 2, nuclear transport factor 2-like export factor 2, protein p15-2

Gene Symbol

NXT2

Additional NXT2 Products

Product Documents for NXT2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NXT2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for NXT2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NXT2 Antibody - Azide and BSA Free and earn rewards!

Have you used NXT2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies