O-GlcNAc Transferase p110 subunit Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55252

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for O-GlcNAc Transferase p110 subunit Antibody - BSA Free

Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP2-55252]

Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP2-55252]

Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP2-55252] - Analysis using Anti-OGT antibody NBP2-55252 (A) shows similar pattern to independent antibody NBP1-89845 (B).
Immunocytochemistry/ Immunofluorescence: O-GlcNAc Transferase p110 subunit Antibody [NBP2-55252]

Immunocytochemistry/ Immunofluorescence: O-GlcNAc Transferase p110 subunit Antibody [NBP2-55252]

Immunocytochemistry/Immunofluorescence: O-GlcNAc Transferase p110 subunit Antibody [NBP2-55252] - Staining of human cell line A-431 shows localization to nucleoplasm.

Applications for O-GlcNAc Transferase p110 subunit Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: O-GlcNAc Transferase/OGT

Diffusion of metabolites and small non-nuclear molecules as well as active, mediated import of protein and export of protein and RNA through the nuclear envelope occurs through nuclear pore complexes or NPC's. NPC's contain up to 100 different polypeptides which have a combined mass of about 125 megadaltons. The channel available for passive transport through the NPC is about 9-10 nm in diameter while carrier mediated changes in the NPC result in a ~25 nm channel used for larger, actively transported molecules. Of the 100 polypeptides, at least 8 of these are O-linked N-acetylglycosamine-modified in mammalian cells. All of the mammalian O-linked glycoproteins contain multiple copies of phenylalanine, glycine dipeptide repeats dispersed throughout part of their sequence. Studies indicate that the NPC O-linked glycoproteins have a direct role in nuclear protein import.

Long Name

O-Linked N-Acetylglucosamine (GlcNAc) Transferase

Alternate Names

HRNT1, OGlcNAc Transferase, OGT

Gene Symbol

OGT

Additional O-GlcNAc Transferase/OGT Products

Product Documents for O-GlcNAc Transferase p110 subunit Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for O-GlcNAc Transferase p110 subunit Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for O-GlcNAc Transferase p110 subunit Antibody - BSA Free

There are currently no reviews for this product. Be the first to review O-GlcNAc Transferase p110 subunit Antibody - BSA Free and earn rewards!

Have you used O-GlcNAc Transferase p110 subunit Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...