OCTN2/SLC22A5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94796

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OCTN2/SLC22A5 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 430-529 of human OCTN2/SLC22A5 (NP_003051.1). VLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAILTLFLPESFGTPLPDTIDQMLRVKG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OCTN2/SLC22A5 Antibody - BSA Free

Western Blot: OCTN2/SLC22A5 AntibodyBSA Free [NBP2-94796]

Western Blot: OCTN2/SLC22A5 AntibodyBSA Free [NBP2-94796]

Western Blot: OCTN2/SLC22A5 Antibody [NBP2-94796] - Analysis of extracts of various cell lines, using SLC22A5 Rabbit pAb at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 3s.
OCTN2/SLC22A5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: OCTN2/SLC22A5 Antibody - BSA Free [NBP2-94796] -

Immunocytochemistry/ Immunofluorescence: OCTN2/SLC22A5 Antibody - BSA Free [NBP2-94796] - Immunofluorescence analysis of HeLa cells using OCTN2/SLC22A5 Rabbit pAb (A1676) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
OCTN2/SLC22A5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: OCTN2/SLC22A5 Antibody - BSA Free [NBP2-94796] -

Immunocytochemistry/ Immunofluorescence: OCTN2/SLC22A5 Antibody - BSA Free [NBP2-94796] - Immunofluorescence analysis of MCF7 cells using OCTN2/SLC22A5 Rabbit pAb (A1676) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
OCTN2/SLC22A5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: OCTN2/SLC22A5 Antibody - BSA Free [NBP2-94796] -

Immunocytochemistry/ Immunofluorescence: OCTN2/SLC22A5 Antibody - BSA Free [NBP2-94796] - Immunofluorescence analysis of NIH/3T3 cells using OCTN2/SLC22A5 Rabbit pAb (A1676) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for OCTN2/SLC22A5 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: OCTN2/SLC22A5

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is a plasma integral membrane protein which functions both as an organic cation transporter and as a sodium-dependent high affinity carnitine transporter. The encoded protein is involved in the active cellular uptake of carnitine. Mutations in this gene are the cause of systemic primary carnitine deficiency (CDSP), an autosomal recessive disorder manifested early in life by hypoketotic hypoglycemia and acute metabolic decompensation, and later in life by skeletal myopathy or cardiomyopathy. [provided by RefSeq]

Long Name

Solute Carrier Family 22 (Organic Cation/Carnitin Transporter) Member 5

Alternate Names

CDSP, OCTN2VT, SCD, SLC22A5

Gene Symbol

SLC22A5

Additional OCTN2/SLC22A5 Products

Product Documents for OCTN2/SLC22A5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OCTN2/SLC22A5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OCTN2/SLC22A5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OCTN2/SLC22A5 Antibody - BSA Free and earn rewards!

Have you used OCTN2/SLC22A5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies