Orai1 is a membrane calcium channel subunit that is activated by the calcium sensor STIM1 when calcium stores are depleted. Orai1 is a pore subunit of Ca(2+) release-activated Ca(2+) CRAC channels, and STIM1 acts as an endoplasmic reticulum (ER) Ca(2+) sensor that detects store depletion. This type of channel is the primary way for calcium influx into T-cells. Defects in Orai1 are a cause of immune dysfunction with T-cell inactivation due to calcium entry defect type 1.
Orai1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85463
![Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463]](https://resources.rndsystems.com/images/products/Orai1-Antibody-Immunohistochemistry-Paraffin-NBP1-85463-img0015.jpg "Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Orai1 Antibody - BSA Free
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463]
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463] - Analysis in human skin and pancreas tissues using NBP1-85463 antibody. Corresponding Orai1 RNA-seq data are presented for the same tissues.![Immunocytochemistry/ Immunofluorescence: Orai1 Antibody [NBP1-85463]](https://resources.rndsystems.com/images/products/Orai1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85463-img0012.jpg "Immunocytochemistry/ Immunofluorescence: Orai1 Antibody [NBP1-85463]")
Immunocytochemistry/ Immunofluorescence: Orai1 Antibody [NBP1-85463]
Immunocytochemistry/Immunofluorescence: Orai1 Antibody [NBP1-85463] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.![Western Blot: Orai1 Antibody [NBP1-85463]](https://resources.rndsystems.com/images/products/Orai1-Antibody-Western-Blot-NBP1-85463-img0013.jpg "Western Blot: Orai1 Antibody [NBP1-85463]")
Western Blot: Orai1 Antibody [NBP1-85463]
Western Blot: Orai1 Antibody [NBP1-85463] - Analysis in human cell line NB4.![Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463]](https://resources.rndsystems.com/images/products/Orai1-Antibody-Immunohistochemistry-Paraffin-NBP1-85463-img0011.jpg "Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463]")
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463]
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463] - Staining of human skin shows membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463] -
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463] - Staining of human duodenum shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463] -
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463] -
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.Applications for Orai1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04 - 0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Orai1
Long Name
ORAI Calcium Release-activated Calcium Modulator 1
Alternate Names
CRACM1, ORAT1, TMEM142A
Gene Symbol
ORAI1
Additional Orai1 Products
Product Documents for Orai1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Orai1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Orai1 Antibody - BSA Free
Powered by Bioz
Customer Reviews for Orai1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Orai1 Antibody - BSA Free and earn rewards!
Have you used Orai1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...