Ornithine Carbamoyltransferase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87408

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Ornithine Carbamoyltransferase/OTC Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWT

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:33228018)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ornithine Carbamoyltransferase Antibody - BSA Free

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining in human liver and kidney tissues. Corresponding OTC RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining of human cerebral cortex, kidney, liver and small intestine using Anti-OTC antibody NBP1-87408 (A) shows similar protein distribution across tissues to independent antibody NBP1-88121 (B).
Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Analysis in human liver tissue.
Immunocytochemistry/ Immunofluorescence: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunocytochemistry/ Immunofluorescence: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunocytochemistry/Immunofluorescence: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining of human kidney shows no positivity as expected.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining of human liver cancer shows moderate to strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Simple Western: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Simple Western: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Simple Western: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Simple Western lane view shows a specific band for OTC in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Simple Western: Ornithine Carbamoyltransferase Antibody [NBP1-87408]

Simple Western: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Electropherogram image(s) of corresponding Simple Western lane view. Ornithine Carbamoyltransferase antibody was used at 1:20 dilution on Liver lysate(s).

Applications for Ornithine Carbamoyltransferase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Liver, separated by Size, antibody dilution of 1:20, apparent MW was 41 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ornithine Carbamoyltransferase/OTC

This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also. (provided by RefSeq)

Alternate Names

OCTD, Ornithine Transcarbamylase, OTC, OTCase

Gene Symbol

OTC

Additional Ornithine Carbamoyltransferase/OTC Products

Product Documents for Ornithine Carbamoyltransferase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ornithine Carbamoyltransferase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Bcl-2 Proteins and Regulators

Citations for Ornithine Carbamoyltransferase Antibody - BSA Free

Customer Reviews for Ornithine Carbamoyltransferase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ornithine Carbamoyltransferase Antibody - BSA Free and earn rewards!

Have you used Ornithine Carbamoyltransferase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies