p53 DINP1 Antibody (9Y6Z7)

Novus Biologicals | Catalog # NBP3-16620

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9Y6Z7 expressed in HEK293
View all p53 DINP1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human p53 DINP1 (Q96A56). PPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for p53 DINP1 Antibody (9Y6Z7)

Western Blot: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620]

Western Blot: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620]

Western Blot: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620] - Western blot analysis of extracts of various cell lines, using p53 DINP1 Rabbit mAb (NBP3-16620) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620]

Immunocytochemistry/ Immunofluorescence: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620]

Immunocytochemistry/Immunofluorescence: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620] - Immunofluorescence analysis of HeLa cells using p53 DINP1 Rabbit mAb (NBP3-16620) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620]

Immunohistochemistry-Paraffin: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620]

Immunohistochemistry-Paraffin: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620] - Immunohistochemistry of paraffin-embedded human liver using p53 DINP1 Rabbit mAb (NBP3-16620) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620]

Western Blot: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620]

Western Blot: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620] - Western blot analysis of extracts of various cell lines, using p53 DINP1 Rabbit mAb (NBP3-16620) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
p53 DINP1 Antibody (9Y6Z7)

Immunocytochemistry/ Immunofluorescence: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620] -

Immunocytochemistry/ Immunofluorescence: p53 DINP1 Antibody (9Y6Z7) [NBP3-16620] - Confocal imaging of HeLa cells using p53 DINP1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for p53 DINP1 Antibody (9Y6Z7)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: p53 DINP1

Apoptosis is related to many diseases and development. The p53 tumor-suppressor protein induces apoptosis through transcriptional activation of several genes. A novel p53 inducible gene was identified recently and designated p53DINP1 (for p53-dependent damage-inducible nuclear protein and SIP (for stress induced protein) in human and mouse. A p53DINP1 antisense oligonucleotide inhibits and overexpression of p53DINP1 enhances Ser46 phosphorylation of p53, induction of p53AIP1, and cell death induced by DNA double-strand breaks. p53DINP1 may regulate p53-dependent apoptosis through phosphorylation at Ser46 and induction of p53AIP1. The p53DINP1/SIP gene encodes two proteins of 27 and 18 kDa in human and mouse termed p53DINP1-a and p53DINP1-b or SIP27 and SIP18. p53DINP1/SIP is expressed in many tissues and induced by a variety of stress agents including UV stress, mutagenic stress, heat shock, and oxidative stress.

Alternate Names

DKFZp434M1317, FLJ22139, p53DINP1, P53DINP1p53-dependent damage-inducible nuclear protein 1, p53-inducible p53DINP1, SIPStress-induced protein, Teap, TP53DINP1, TP53INP1A, TP53INP1B, tumor protein p53 inducible nuclear protein 1, tumor protein p53-inducible nuclear protein 1

Gene Symbol

TP53INP1

Additional p53 DINP1 Products

Product Documents for p53 DINP1 Antibody (9Y6Z7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for p53 DINP1 Antibody (9Y6Z7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for p53 DINP1 Antibody (9Y6Z7)

There are currently no reviews for this product. Be the first to review p53 DINP1 Antibody (9Y6Z7) and earn rewards!

Have you used p53 DINP1 Antibody (9Y6Z7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies