p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Novus Biologicals | Catalog # NBP3-16752

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5D8F5 expressed in HEK293
View all p70 S6 Kinase beta Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human p70 S6 Kinase beta/S6K2 (Q9UBS0). MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit p70 S6 Kinase beta/S6K2 Antibody (5D8F5) (NBP3-16752) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Western Blot: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752]

Western Blot: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752]

Western Blot: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Western blot analysis of extracts of Mouse brain, using p70 S6 Kinase beta/S6K2 Rabbit mAb (NBP3-16752) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] -

Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Confocal imaging of C2C12 cells using p70 S6 Kinase beta/S6K2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] -

Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Confocal imaging of NIH/3T3 cells using p70 S6 Kinase beta/S6K2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] -

Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Confocal imaging of U-2 OS cells using p70 S6 Kinase beta/S6K2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] -

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Immunohistochemistry analysis of p70 S6 Kinase beta/S6K2 in paraffin-embedded human cervix cancer tissue using p70 S6 Kinase beta/S6K2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] -

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Immunohistochemistry analysis of p70 S6 Kinase beta/S6K2 in paraffin-embedded mouse kidney tissue using p70 S6 Kinase beta/S6K2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] -

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Immunohistochemistry analysis of p70 S6 Kinase beta/S6K2 in paraffin-embedded human colon carcinoma tissue using p70 S6 Kinase beta/S6K2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] -

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Immunohistochemistry analysis of p70 S6 Kinase beta/S6K2 in paraffin-embedded rat colon tissue using p70 S6 Kinase beta/S6K2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: p70 S6 Kinase beta

S6K2 encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates the S6 ribosomal protein and eucaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation.

Alternate Names

KLS, p70-beta, RPS6KB2, STK14B

Gene Symbol

RPS6KB2

Additional p70 S6 Kinase beta Products

Product Documents for p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

There are currently no reviews for this product. Be the first to review p70 S6 Kinase beta/S6K2 Antibody (5D8F5) and earn rewards!

Have you used p70 S6 Kinase beta/S6K2 Antibody (5D8F5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies