PABPN1 Antibody (7V4X8)
Novus Biologicals | Catalog # NBP3-15539
Recombinant Monoclonal Antibody
![Western Blot: PABPN1 Antibody (7V4X8) [NBP3-15539]](https://resources.rndsystems.com/images/products/PABPN1-Antibody-7V4X8-Western-Blot-NBP3-15539-img0007.jpg "Western Blot: PABPN1 Antibody (7V4X8) [NBP3-15539]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 7V4X8 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PABPN1 (Q86U42). MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for PABPN1 Antibody (7V4X8)
Western Blot: PABPN1 Antibody (7V4X8) [NBP3-15539]
Western Blot: PABPN1 Antibody (7V4X8) [NBP3-15539] - Western blot analysis of extracts of various cell lines, using PABPN1 Rabbit mAb (NBP3-15539) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] - Confocal imaging of C2C12 cells using PABPN1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] - Confocal imaging of U-2 OS cells using PABPN1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] - Confocal imaging of paraffin-embedded Human colon cancer using PABPN1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] -
Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Applications for PABPN1 Antibody (7V4X8)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: PABPN1
Alternate Names
Nuclear poly(A)-binding protein 1, OPMD, PAB2poly(A) binding protein II, PABII, PABP-2, PABP2polyadenylate-binding protein 2, poly(A) binding protein 2, poly(A) binding protein, nuclear 1, Poly(A)-binding protein 2, Poly(A)-binding protein II, poly(A)-binding protein, nuclear 1, Polyadenylate-binding nuclear protein 1
Gene Symbol
PABPN1
Additional PABPN1 Products
Product Documents for PABPN1 Antibody (7V4X8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PABPN1 Antibody (7V4X8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PABPN1 Antibody (7V4X8)
There are currently no reviews for this product. Be the first to review PABPN1 Antibody (7V4X8) and earn rewards!
Have you used PABPN1 Antibody (7V4X8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...