PACSIN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13723

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PACSIN2 Antibody - BSA Free

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining in human adrenal gland and skeletal muscle tissues using NBP2-13723 antibody. Corresponding PACSIN2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human adrenal gland, kidney, pancreas and skeletal muscle using Anti-PACSIN2 antibody NBP2-13723 (A) shows similar protein distribution across tissues to independent antibody NBP2-56701 (B).
Immunocytochemistry/ Immunofluorescence: PACSIN2 Antibody [NBP2-13723]

Immunocytochemistry/ Immunofluorescence: PACSIN2 Antibody [NBP2-13723]

Immunocytochemistry/Immunofluorescence: PACSIN2 Antibody [NBP2-13723] - Staining of human cell line CACO-2 shows localization to nuclear speckles, plasma membrane, cytosol & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human adrenal gland shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723]

Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for PACSIN2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PACSIN2

PACSIN2 may play a role in vesicle formation and transport

Alternate Names

cytoplasmic phosphoprotein PACSIN2, protein kinase C and casein kinase substrate in neurons 2, protein kinase C and casein kinase substrate in neurons protein 2, SDPII, syndapin II

Gene Symbol

PACSIN2

Additional PACSIN2 Products

Product Documents for PACSIN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PACSIN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PACSIN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PACSIN2 Antibody - BSA Free and earn rewards!

Have you used PACSIN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...