Pancreatic Amylase Alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38499

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Pancreatic Amylase Alpha Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 16-511 of human Pancreatic Amylase Alpha (NP_000690.1).

Sequence:
KPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Pancreatic Amylase Alpha Antibody - BSA Free

Pancreatic Amylase Alpha Antibody

Immunocytochemistry/ Immunofluorescence: Pancreatic Amylase Alpha Antibody [NBP3-38499] -

Immunocytochemistry/ Immunofluorescence: Pancreatic Amylase Alpha Antibody [NBP3-38499] - Immunofluorescence analysis of paraffin-embedded mouse pancreas using Pancreatic Amylase Alpha Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Pancreatic Amylase Alpha Antibody

Immunocytochemistry/ Immunofluorescence: Pancreatic Amylase Alpha Antibody [NBP3-38499] -

Immunocytochemistry/ Immunofluorescence: Pancreatic Amylase Alpha Antibody [NBP3-38499] - Immunofluorescence analysis of paraffin-embedded rat pancreas using Pancreatic Amylase Alpha Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Pancreatic Amylase Alpha Antibody

Immunocytochemistry/ Immunofluorescence: Pancreatic Amylase Alpha Antibody [NBP3-38499] -

Immunocytochemistry/ Immunofluorescence: Pancreatic Amylase Alpha Antibody [NBP3-38499] - Immunofluorescence analysis of paraffin-embedded human pancreas using Pancreatic Amylase Alpha Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Pancreatic Amylase Alpha Antibody

Western Blot: Pancreatic Amylase Alpha Antibody [NBP3-38499] -

Western Blot: Pancreatic Amylase Alpha Antibody [NBP3-38499] - Western Blot analysis of lysates from wild type (WT) and 293T cells transfected with Pancreatic Amylase Alpha using Pancreatic Amylase Alpha Rabbit pAbat 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit.
Exposuretime: 10s.

Applications for Pancreatic Amylase Alpha Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Pancreatic Amylase Alpha

Alternate Names

AMY2, AMY2A amylase, alpha 2A (pancreatic), AMY2B, PA, pancreatic alpha-amylase

Gene Symbol

AMY2A

Additional Pancreatic Amylase Alpha Products

Product Documents for Pancreatic Amylase Alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Pancreatic Amylase Alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Pancreatic Amylase Alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pancreatic Amylase Alpha Antibody - BSA Free and earn rewards!

Have you used Pancreatic Amylase Alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies