PARP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13732

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Predicted:

Rat (94%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:34890590).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PARP Antibody - BSA Free

Western Blot: PARP Antibody [NBP2-13732]

Western Blot: PARP Antibody [NBP2-13732]

Western Blot: PARP Antibody [NBP2-13732] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: PARP Antibody [NBP2-13732]

Immunocytochemistry/ Immunofluorescence: PARP Antibody [NBP2-13732]

Immunocytochemistry/Immunofluorescence: PARP Antibody [NBP2-13732] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human lymph node shows strong nuclear positivity in lymphoid cells.
Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human pancreas shows strong nuclear positivity.
Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human parathyroid gland shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Applications for PARP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP2-13732 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PARP

Poly (ADP-ribose) polymerase (PARP) is protein family primarily invloved in DNA repair and programmed cell death. PARP proteins are activated in response to DNA single strand breaks (SSBs). Upon SSB detection, PARP binds the DNA and synthesizes a PAR chain at the damaged site, which then signals the initiation of DNA repair by other enzymes such as XRCC1, DNA ligase III and DNA polymerase beta. After repair, the PAR chains are degraded via PAR glycohydrolase.

PARP is inactivated by caspase cleavage, leading to a programmed cell death pathway.

Long Name

Poly [ADP-ribose] Polymerase

Alternate Names

ADPRT, PARP1, PPOL

Gene Symbol

PARP1

Additional PARP Products

Product Documents for PARP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PARP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PARP Antibody - BSA Free

Customer Reviews for PARP Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used PARP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • Name: Ranveer Singh
    Application: Western Blot
    Sample Tested: HEK293T cells whole cell lysate
    Species: Human
    Verified Customer | Posted 07/22/2014
    WB with total lysate from HEK293T cells
    PARP Antibody - BSA Free NBP2-13732

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PARP Antibody - BSA Free

Showing  1 - 3 of 3 FAQs Showing All
  • Q: could you please confirm how many approx tests ihc can nbp2-13732 can performed?

    A: For this antibody we recommend a 1:1000 - 1:2500 dilution for immunohistochemistry. If you get the 100ul unit, you will get 100ml of working solution. Usually 50ul working solution is added to the tissue. Depending on the tissue type, you can perform approximately 2000 assays.

  • Q: Do you have any 100 coda or bigger controls?

    A: I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

  • Q: I was wondering if you would mind letting me know which product would you recommend for immunochemistry of the retina of the rat and mouse by poly (ADP-ribose) polymerase (PARP) and calpain. There are many different calpain antibodies in your website. The samples are 12-um vertical cryostst sections (fixed by PFA).

    A: For PARP, I would recommend either NB120-2168 or NB100-64828. Bear in mind that they are both mouse monoclonals, and you may have to take extra steps to reduce mouse-on-mouse background.

  • Q: could you please confirm how many approx tests ihc can nbp2-13732 can performed?

    A: For this antibody we recommend a 1:1000 - 1:2500 dilution for immunohistochemistry. If you get the 100ul unit, you will get 100ml of working solution. Usually 50ul working solution is added to the tissue. Depending on the tissue type, you can perform approximately 2000 assays.

  • Q: Do you have any 100 coda or bigger controls?

    A: I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

  • Q: I was wondering if you would mind letting me know which product would you recommend for immunochemistry of the retina of the rat and mouse by poly (ADP-ribose) polymerase (PARP) and calpain. There are many different calpain antibodies in your website. The samples are 12-um vertical cryostst sections (fixed by PFA).

    A: For PARP, I would recommend either NB120-2168 or NB100-64828. Bear in mind that they are both mouse monoclonals, and you may have to take extra steps to reduce mouse-on-mouse background.

  • Q: could you please confirm how many approx tests ihc can nbp2-13732 can performed?

    A: For this antibody we recommend a 1:1000 - 1:2500 dilution for immunohistochemistry. If you get the 100ul unit, you will get 100ml of working solution. Usually 50ul working solution is added to the tissue. Depending on the tissue type, you can perform approximately 2000 assays.

  • Q: Do you have any 100 coda or bigger controls?

    A: I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

  • Q: I was wondering if you would mind letting me know which product would you recommend for immunochemistry of the retina of the rat and mouse by poly (ADP-ribose) polymerase (PARP) and calpain. There are many different calpain antibodies in your website. The samples are 12-um vertical cryostst sections (fixed by PFA).

    A: For PARP, I would recommend either NB120-2168 or NB100-64828. Bear in mind that they are both mouse monoclonals, and you may have to take extra steps to reduce mouse-on-mouse background.

Showing  1 - 3 of 3 FAQs Showing All
View all FAQs for Antibodies
Loading...