PARP Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-13732
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human, Mouse
Cited:
Human, Mouse
Predicted:
Rat (94%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM
Reactivity Notes
Use in Mouse reported in scientific literature (PMID:34890590).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit PARP Antibody - BSA Free (NBP2-13732) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PARP Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for PARP Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: PARP Antibody [NBP2-13732]
Immunocytochemistry/Immunofluorescence: PARP Antibody [NBP2-13732] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]
Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]
Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human lymph node shows strong nuclear positivity in lymphoid cells.Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]
Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human pancreas shows strong nuclear positivity.Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]
Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human parathyroid gland shows strong nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732]
Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.Applications for PARP Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 5 using NBP2-13732 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PARP
PARP is inactivated by caspase cleavage, leading to a programmed cell death pathway.
Long Name
Poly [ADP-ribose] Polymerase
Alternate Names
ADPRT, PARP1, PPOL
Gene Symbol
PARP1
Additional PARP Products
Product Documents for PARP Antibody - BSA Free
Product Specific Notices for PARP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for PARP Antibody - BSA Free
Customer Reviews for PARP Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used PARP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: HEK293T cells whole cell lysateSpecies: HumanVerified Customer | Posted 07/22/2014WB with total lysate from HEK293T cells
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for PARP Antibody - BSA Free
Showing
1
-
3 of
3 FAQs
Showing All
-
A: For this antibody we recommend a 1:1000 - 1:2500 dilution for immunohistochemistry. If you get the 100ul unit, you will get 100ml of working solution. Usually 50ul working solution is added to the tissue. Depending on the tissue type, you can perform approximately 2000 assays.
-
A: I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.
-
Q: I was wondering if you would mind letting me know which product would you recommend for immunochemistry of the retina of the rat and mouse by poly (ADP-ribose) polymerase (PARP) and calpain. There are many different calpain antibodies in your website. The samples are 12-um vertical cryostst sections (fixed by PFA).
A: For PARP, I would recommend either NB120-2168 or NB100-64828. Bear in mind that they are both mouse monoclonals, and you may have to take extra steps to reduce mouse-on-mouse background.
Loading...