Parvalbumin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33529

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Rat

Cited:

Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Parvalbumin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 28835932). Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Parvalbumin Antibody - BSA Free

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Analysis in human parathyroid gland and liver tissues. Corresponding Parvalbumin RNA-seq data are presented for the same tissues.
Western Blot: Parvalbumin Antibody [NBP2-33529]

Western Blot: Parvalbumin Antibody [NBP2-33529]

Western Blot: Parvalbumin Antibody [NBP2-33529] - Analysis in human cell line RPMI-8226.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human cerebellum shows strong positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human cerebral cortex shows strong positivity in a small subset of neurons.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529]

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human kidney shows strong positivity in cells in distal tubules.

Applications for Parvalbumin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Parvalbumin

Parvalbumin is encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation.

Alternate Names

D22S749, MGC116759, parvalbumin, parvalbumin alpha, PV

Gene Symbol

PVALB

UniProt

P20472

Additional Parvalbumin Products

Product Documents for Parvalbumin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Parvalbumin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Parvalbumin Antibody - BSA Free

Customer Reviews for Parvalbumin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Parvalbumin Antibody - BSA Free and earn rewards!

Have you used Parvalbumin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Parvalbumin Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?

    A:

    We currently have three alpha7 nicotinic cholingergic receptor antibodies available for purchase. Please see this list for our Parvalbumin antibodies. None are currently validated in mouse. I would like to introduce you to our Innovators Reward Program. We have an excelent calbinin D28K antibody that has been validated for use in human and mouse and WB. The pricing and availability of our products depends on your country.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies