PAUF/ZG16B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81699

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PAUF/ZG16B Antibody - BSA Free

Western Blot: PAUF/ZG16B Antibody [NBP1-81699]

Western Blot: PAUF/ZG16B Antibody [NBP1-81699]

Western Blot: PAUF/ZG16B Antibody [NBP1-81699] - Analysis in human cell line MCF-7.
PAUF/ZG16B Antibody - BSA Free Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Analysis in human salivary gland and testis tissues. Corresponding RNA-seq data are presented for the same tissues.
PAUF/ZG16B Antibody - BSA Free Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
PAUF/ZG16B Antibody - BSA Free Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
PAUF/ZG16B Antibody - BSA Free Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Staining of human liver shows no positivity in hepatocytes as expected.
PAUF/ZG16B Antibody - BSA Free Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.
PAUF/ZG16B Antibody - BSA Free Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699]

Staining of human liver, salivary gland, skeletal muscle and testis HPA041125 (A) shows similar protein distribution across tissues to independent antibody HPA053549 (B).

Applications for PAUF/ZG16B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAUF/ZG16B

PAUF (pancreatic adenocarcinoma upregulated factor), gene name ZG16B (zymogen granule protein 16B), is a 156 amino acid, approximately 20-25 kDa secreted protein that is a member of the jacalin-binding lectin family. PAUF expression is thought to be restricted to primates, but the related ZG16P, which shares approximately 25% amino acid sequence identity, is more widely expressed. Human PAUF is overexpressed in pancreatic adenocarcinoma, binds Toll-like receptors TLR2 and TLR4, and inhibits CXCR4-dependent, TLR2-mediated NF-kB activation. It facilitates tumor growth, adhesiveness, and production of pro-tumorigenic cytokines.

Long Name

Pancreatic Adenocarcinoma Upregulated Factor

Alternate Names

EECP, HRPE773, JCLN2, LOC124220, PRO1567, ZG16B

Gene Symbol

ZG16B

Additional PAUF/ZG16B Products

Product Documents for PAUF/ZG16B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAUF/ZG16B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAUF/ZG16B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAUF/ZG16B Antibody - BSA Free and earn rewards!

Have you used PAUF/ZG16B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...