PCK2 Antibody (10L10J8)

Novus Biologicals | Catalog # NBP3-16418

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10L10J8 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 550-640 of human PEPCK/PCK2 (Q16822). ENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PCK2 Antibody (10L10J8)

Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418]

Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418]

Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418] - Western blot analysis of extracts of various cell lines, using PEPCK/PCK2 Rabbit mAb (NBP3-16418) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418]

Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418]

Immunocytochemistry/Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] - Immunofluorescence analysis of HeLa cells using PEPCK/PCK2 Rabbit mAb (NBP3-16418) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
PCK2 Antibody (10L10J8)

Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] -

Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] - Confocal imaging of C2C12 cells using [KO Validated] PCK2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
PCK2 Antibody (10L10J8)

Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418] -

Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418] - Western blot analysis of lysates from wild type(WT) and PCK2 knockout (KO) 293T cells, using [KO Validated] PCK2 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
PCK2 Antibody (10L10J8)

Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] -

Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] - Confocal imaging of HeLa cells using [KO Validated] PCK2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for PCK2 Antibody (10L10J8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PCK2

PCK2 encodes a member of the phosphoenolpyruvate carboxykinase (GTP) family. The protein is a mitochondrial enzyme that catalyzes the conversion of oxaloacetate to phosphoenolpyruvate in the presence of GTP. A cytosolic form encoded by a different gene has also been characterized and is the key enzyme of gluconeogenesis in the liver. The encoded protein may serve a similar function, although it is constitutively expressed and not modulated by hormones such as glucagon and insulin that regulate the cytosolic form. Alternatively spliced transcript variants have been described.

Alternate Names

EC 4.1.1.32, PE, PEPCK, PEPCK2PEP carboxykinase, PEPCK-M, phosphoenolpyruvate carboxykinase [GTP], mitochondrial, phosphoenolpyruvate carboxykinase 2 (mitochondrial), Phosphoenolpyruvate carboxylase, phosphopyruvate carboxylase

Gene Symbol

PCK2

Additional PCK2 Products

Product Documents for PCK2 Antibody (10L10J8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCK2 Antibody (10L10J8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCK2 Antibody (10L10J8)

There are currently no reviews for this product. Be the first to review PCK2 Antibody (10L10J8) and earn rewards!

Have you used PCK2 Antibody (10L10J8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...