PCK2 Antibody (10L10J8)
Novus Biologicals | Catalog # NBP3-16418
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 10L10J8 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 550-640 of human PEPCK/PCK2 (Q16822). ENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for PCK2 Antibody (10L10J8)
Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418]
Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418] - Western blot analysis of extracts of various cell lines, using PEPCK/PCK2 Rabbit mAb (NBP3-16418) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418]
Immunocytochemistry/Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] - Immunofluorescence analysis of HeLa cells using PEPCK/PCK2 Rabbit mAb (NBP3-16418) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] -
Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] - Confocal imaging of C2C12 cells using [KO Validated] PCK2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418] -
Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418] - Western blot analysis of lysates from wild type(WT) and PCK2 knockout (KO) 293T cells, using [KO Validated] PCK2 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] -
Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] - Confocal imaging of HeLa cells using [KO Validated] PCK2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Applications for PCK2 Antibody (10L10J8)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: PCK2
Alternate Names
EC 4.1.1.32, PE, PEPCK, PEPCK2PEP carboxykinase, PEPCK-M, phosphoenolpyruvate carboxykinase [GTP], mitochondrial, phosphoenolpyruvate carboxykinase 2 (mitochondrial), Phosphoenolpyruvate carboxylase, phosphopyruvate carboxylase
Gene Symbol
PCK2
Additional PCK2 Products
Product Documents for PCK2 Antibody (10L10J8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PCK2 Antibody (10L10J8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PCK2 Antibody (10L10J8)
There are currently no reviews for this product. Be the first to review PCK2 Antibody (10L10J8) and earn rewards!
Have you used PCK2 Antibody (10L10J8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...