Pepsinogen C/PGC/Progastricsin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91012

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Pepsinogen C/PGC Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Pepsinogen C/PGC/Progastricsin Antibody - BSA Free

Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012]

Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012]

Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012] - Staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012]

Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012]

Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012] - Staining of human cerebral cortex, colon, skeletal muscle and stomach using Anti-PGC antibody NBP1-91012 (A) shows similar protein distribution across tissues to independent antibody NBP1-91011 (B).
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012]

Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012]

Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012] - Analysis in human stomach and skeletal muscle tissues. Corresponding PGC RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012]

Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012]

Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012]

Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012]

Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Pepsinogen C/PGC/Progastricsin Antibody - BSA Free Immunohistochemistry: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91012]

Immunohistochemistry: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91012]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Pepsinogen C/PGC/Progastricsin Antibody - BSA Free Western Blot: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91012]

Western Blot: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91012]

Analysis in control (vector only transfected HEK293T lysate) and PGC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for Pepsinogen C/PGC/Progastricsin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Pepsinogen C/PGC

The Progastricsin gene encodes an aspartic proteinase that belongs to the peptidase family A1. The encoded protein is a digestive enzyme that is produced in the stomach and constitutes a major component of the gastric mucosa. This protein is also secreted into the ser

Alternate Names

Gastricsin, PEPC, PGC, PGII

Gene Symbol

PGC

Additional Pepsinogen C/PGC Products

Product Documents for Pepsinogen C/PGC/Progastricsin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Pepsinogen C/PGC/Progastricsin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Aspartic Proteases and Regulators

Customer Reviews for Pepsinogen C/PGC/Progastricsin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pepsinogen C/PGC/Progastricsin Antibody - BSA Free and earn rewards!

Have you used Pepsinogen C/PGC/Progastricsin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies