PEX12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49599

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PEX12 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSAL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PEX12 Antibody - BSA Free

Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599]

Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599]

Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599] - Staining in human epididymis and bone marrow tissues using anti-PEX12 antibody. Corresponding PEX12 RNA-seq data are presented for the same tissues.
Western Blot: PEX12 Antibody [NBP2-49599]

Western Blot: PEX12 Antibody [NBP2-49599]

Western Blot: PEX12 Antibody [NBP2-49599] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599]

Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599]

Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599]

Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599]

Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599] - Staining of human bone marrow shows low expression as expected.

Applications for PEX12 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PEX12

The PEX12 gene belongs to the peroxin-12 family. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal disease

Alternate Names

PAF3, PAF-3, peroxin 12, peroxin-12, peroxisomal biogenesis factor 12, Peroxisome assembly factor 3, peroxisome assembly protein 12

Gene Symbol

PEX12

Additional PEX12 Products

Product Documents for PEX12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PEX12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PEX12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PEX12 Antibody - BSA Free and earn rewards!

Have you used PEX12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies