PEX5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38443

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RAQAEQWAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSAIESDVDFWDKLQAELEEMAKRDAEAHPWLSDYDDLTSATYDKGYQFEEEN

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:31996685).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PEX5 Antibody - BSA Free

Western Blot: PEX5 Antibody [NBP2-38443]

Western Blot: PEX5 Antibody [NBP2-38443]

Western Blot: PEX5 Antibody [NBP2-38443] - Analysis using Anti-PEX5 antibody NBP2-38443 (A) shows similar pattern to independent antibody NBP1-87185 (B).
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining in human testis and pancreas tissues using anti-PEX5 antibody. Corresponding PEX5 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: PEX5 Antibody [NBP2-38443]

Immunocytochemistry/ Immunofluorescence: PEX5 Antibody [NBP2-38443]

Immunocytochemistry/Immunofluorescence: PEX5 Antibody [NBP2-38443] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human testis using Anti-PEX5 antibody NBP2-38443.
Western Blot: PEX5 Antibody [NBP2-38443]

Western Blot: PEX5 Antibody [NBP2-38443]

Western Blot: PEX5 Antibody [NBP2-38443] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PEX5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-PEX5 antibody NBP2-38443 (A) shows similar protein distribution across tissues to independent antibody NBP1-87185 (B).
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human colon.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human lymph node.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human cerebral cortex.
Knockdown Validated: PEX5 Antibody [NBP2-38443]

Western Blot: PEX5 Antibody [NBP2-38443] -

PEX5-Antibody-Knockdown-Validated-NBP2-38443-img0016.jpg
PEX5 Antibody

Western Blot: PEX5 Antibody [NBP2-38443] -

Western Blot: PEX5 Antibody [NBP2-38443] - PEX5 escorts ATGL to LD to mediate fasting-induced lipolysis.a Relative glycerol release from adipocytes transfected with negative control (NC) or PEX5 siRNA(siPEX5) for 48 h. n = 3 for each group. b Relative glycerol release from adipocytes transfected with siNC or siPEX5 for 48 h together in the absence or presence of WY-14643 (10 μM) treatment. n = 3 for each group. c Relative glycerol release from adipocytes transfected with siNC or siACOX1 for 48 h. n = 3 for each group. d, e Representative SIM images & quantification analysis of recruited ATGL to LDs in adipocytes immunostained with endogenous PLIN1 (red) & ATGL (green). Cells were transfected with siNC or siPEX5. n = 10 cells for siNC group; n = 15 cells treated with ISO; n = 12 cells for siPEX5 group; n = 13 cells for siPEX5 treated with ISO. Quantification of ATGL recruitment to LDs was measured using imageJ software. f Representative SIM z-section images (left) & fluorescence intensity profiles from the indicated line scans (right). Below 0.2 fluorescence intensity indicates background fluorescence signal. LD areas are highlighted in yellow. g Western blot of whole cell extracts (WCE) or LD fractionation from adipocytes transfected with siNC or siPEX5. 30 μg of protein from WCE; 20 μg of protein from LD fraction. h Quantification of ATGL in LDs normalized to PLIN1 from g. n = 4 independent experiments. CON control, ISO isoproterenol. Cells were treated with ISO (1 μM) for 1 h. All scale bars, 10 μm. Data represent the mean ± SD; *P < 0.05, ***P < 0.01 in two-way ANOVA followed by Turkey’s post-hoc test. n.s., not statistically significant. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31996685), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PEX5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PEX5

The product of the PEX5 gene binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neonatal adrenoleukodystrophy (NALD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD). Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Alternate Names

FLJ50634, FLJ50721, Peroxin-5, peroxisomal biogenesis factor 5, Peroxisomal C-terminal targeting signal import receptor, peroxisomal targeting signal 1 receptor, peroxisomal targeting signal import receptor, peroxisomal targeting signal receptor 1, Peroxisome receptor 1peroxin-5, PTS1 receptor, PTS1-BP, PTS1RFLJ51948, PXR1peroxisomal targeting signal 1 (SKL type) receptor

Gene Symbol

PEX5

UniProt

Additional PEX5 Products

Product Documents for PEX5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PEX5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PEX5 Antibody - BSA Free

Customer Reviews for PEX5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PEX5 Antibody - BSA Free and earn rewards!

Have you used PEX5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...