PEX5 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-38443
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human, Mouse
Cited:
Human, Mouse
Predicted:
Rat (92%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RAQAEQWAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSAIESDVDFWDKLQAELEEMAKRDAEAHPWLSDYDDLTSATYDKGYQFEEEN
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID:31996685).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for PEX5 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: PEX5 Antibody [NBP2-38443]
Immunocytochemistry/Immunofluorescence: PEX5 Antibody [NBP2-38443] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human testis using Anti-PEX5 antibody NBP2-38443.Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human pancreas shows low expression as expected.Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human testis shows high expression.Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-PEX5 antibody NBP2-38443 (A) shows similar protein distribution across tissues to independent antibody NBP1-87185 (B).Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human colon.Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human lymph node.Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443]
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human cerebral cortex.Western Blot: PEX5 Antibody [NBP2-38443] -
Western Blot: PEX5 Antibody [NBP2-38443] - PEX5 escorts ATGL to LD to mediate fasting-induced lipolysis.a Relative glycerol release from adipocytes transfected with negative control (NC) or PEX5 siRNA(siPEX5) for 48 h. n = 3 for each group. b Relative glycerol release from adipocytes transfected with siNC or siPEX5 for 48 h together in the absence or presence of WY-14643 (10 μM) treatment. n = 3 for each group. c Relative glycerol release from adipocytes transfected with siNC or siACOX1 for 48 h. n = 3 for each group. d, e Representative SIM images & quantification analysis of recruited ATGL to LDs in adipocytes immunostained with endogenous PLIN1 (red) & ATGL (green). Cells were transfected with siNC or siPEX5. n = 10 cells for siNC group; n = 15 cells treated with ISO; n = 12 cells for siPEX5 group; n = 13 cells for siPEX5 treated with ISO. Quantification of ATGL recruitment to LDs was measured using imageJ software. f Representative SIM z-section images (left) & fluorescence intensity profiles from the indicated line scans (right). Below 0.2 fluorescence intensity indicates background fluorescence signal. LD areas are highlighted in yellow. g Western blot of whole cell extracts (WCE) or LD fractionation from adipocytes transfected with siNC or siPEX5. 30 μg of protein from WCE; 20 μg of protein from LD fraction. h Quantification of ATGL in LDs normalized to PLIN1 from g. n = 4 independent experiments. CON control, ISO isoproterenol. Cells were treated with ISO (1 μM) for 1 h. All scale bars, 10 μm. Data represent the mean ± SD; *P < 0.05, ***P < 0.01 in two-way ANOVA followed by Turkey’s post-hoc test. n.s., not statistically significant. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31996685), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for PEX5 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PEX5
Alternate Names
FLJ50634, FLJ50721, Peroxin-5, peroxisomal biogenesis factor 5, Peroxisomal C-terminal targeting signal import receptor, peroxisomal targeting signal 1 receptor, peroxisomal targeting signal import receptor, peroxisomal targeting signal receptor 1, Peroxisome receptor 1peroxin-5, PTS1 receptor, PTS1-BP, PTS1RFLJ51948, PXR1peroxisomal targeting signal 1 (SKL type) receptor
Gene Symbol
PEX5
UniProt
Additional PEX5 Products
Product Documents for PEX5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PEX5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for PEX5 Antibody - BSA Free
Customer Reviews for PEX5 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PEX5 Antibody - BSA Free and earn rewards!
Have you used PEX5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...