PHGDH Antibody (4A3-1D6) - Azide and BSA Free
Novus Biologicals | Catalog # H00026227-M01
![Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]](https://beta-resources.rndsystems.com/images/products/PHGDH-Antibody-4A3-1D6-Western-Blot-H00026227-M01-img0018.jpg "Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 4A3-1D6
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
PHGDH (AAH11262.1, 1 a.a. ~ 533 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
Reactivity Notes
Human. Other species not tested.
Specificity
PHGDH - phosphoglycerate dehydrogenase
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
Novus Biologicals Mouse PHGDH Antibody (4A3-1D6) - Azide and BSA Free (H00026227-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. Anti-PHGDH Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for PHGDH Antibody (4A3-1D6) - Azide and BSA Free
Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]
Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - PHGDH monoclonal antibody (M01), clone 4A3-1D6. Analysis of PHGDH expression in human liver.![Immunocytochemistry/ Immunofluorescence: PHGDH Antibody (4A3-1D6) [H00026227-M01]](https://beta-resources.rndsystems.com/images/products/PHGDH-Antibody-4A3-1D6-Immunocytochemistry-Immunofluorescence-H00026227-M01-img0010.jpg "Immunocytochemistry/ Immunofluorescence: PHGDH Antibody (4A3-1D6) [H00026227-M01]")
Immunocytochemistry/ Immunofluorescence: PHGDH Antibody (4A3-1D6) [H00026227-M01]
Immunocytochemistry/Immunofluorescence: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of monoclonal antibody to PHGDH on HeLa cell. Antibody concentration 1 ~ 10 ug/ml.![Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01]](https://beta-resources.rndsystems.com/images/products/PHGDH-Antibody-4A3-1D6-Immunohistochemistry-Paraffin-H00026227-M01-img0014.jpg "Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01]")
Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01]
Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.![Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]](https://beta-resources.rndsystems.com/images/products/PHGDH-Antibody-4A3-1D6-Western-Blot-H00026227-M01-img0016.jpg "Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]")
Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]
Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - PHGDH monoclonal antibody (M01), clone 4A3-1D6. Analysis of PHGDH expression in A-431.![Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]](https://beta-resources.rndsystems.com/images/products/PHGDH-Antibody-4A3-1D6-Western-Blot-H00026227-M01-img0017.jpg "Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]")
Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]
Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - PHGDH monoclonal antibody (M01), clone 4A3-1D6 Analysis of PHGDH expression in Jurkat.![Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]](https://beta-resources.rndsystems.com/images/products/PHGDH-Antibody-4A3-1D6-Western-Blot-H00026227-M01-img0019.jpg "Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]")
Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01]
Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of PHGDH expression in transfected 293T cell line by PHGDH monoclonal antibody (M01), clone 4A3-1D6.Lane 1: PHGDH transfected lysate(56.7 KDa).Lane 2: Non-transfected lysate.![Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01]](https://beta-resources.rndsystems.com/images/products/PHGDH-Antibody-4A3-1D6-Immunohistochemistry-Paraffin-H00026227-M01-img0012.jpg "Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01]")
Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01]
Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human lymph node. Antibody concentration 1 ~ 10 ug/ml.![Immunoprecipitation: PHGDH Antibody (4A3-1D6) [H00026227-M01]](https://beta-resources.rndsystems.com/images/products/PHGDH-Antibody-4A3-1D6-Immunoprecipitation-H00026227-M01-img0015.jpg "Immunoprecipitation: PHGDH Antibody (4A3-1D6) [H00026227-M01]")
Immunoprecipitation: PHGDH Antibody (4A3-1D6) [H00026227-M01]
Immunoprecipitation: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of PHGDH transfected lysate using anti-PHGDH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PHGDH MaxPab rabbit polyclonal antibody.Applications for PHGDH Antibody (4A3-1D6) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactive against recominant protein, tissue lysate and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: PHGDH
Long Name
3-Phosphoglycerate Dehydrogenase
Alternate Names
3PGDH, PDGH3
Entrez Gene IDs
26227 (Human)
Gene Symbol
PHGDH
OMIM
601 (Human)
UniProt
Additional PHGDH Products
Product Documents for PHGDH Antibody (4A3-1D6) - Azide and BSA Free
Product Specific Notices for PHGDH Antibody (4A3-1D6) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for PHGDH Antibody (4A3-1D6) - Azide and BSA Free
Powered by Bioz
Customer Reviews for PHGDH Antibody (4A3-1D6) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review PHGDH Antibody (4A3-1D6) - Azide and BSA Free and earn rewards!
Have you used PHGDH Antibody (4A3-1D6) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...