PHGDH Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87311

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PHGDH Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PHGDH Antibody - BSA Free

Western Blot: PHGDH Antibody [NBP1-87311]

Western Blot: PHGDH Antibody [NBP1-87311]

Western Blot: PHGDH Antibody [NBP1-87311] - Analysis in human cell lines SK-MEL-30 and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/ Immunofluorescence: PHGDH Antibody [NBP1-87311]

Immunocytochemistry/ Immunofluorescence: PHGDH Antibody [NBP1-87311]

Immunocytochemistry/Immunofluorescence: PHGDH Antibody [NBP1-87311] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311]

Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311]

Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal and glial cells.
Western Blot: PHGDH Antibody [NBP1-87311]

Western Blot: PHGDH Antibody [NBP1-87311]

Western Blot: PHGDH Antibody [NBP1-87311] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311]

Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311]

Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311]

Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311]

Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human breast cancer shows moderate to strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311]

Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311]

Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Simple Western: PHGDH Antibody [NBP1-87311]

Simple Western: PHGDH Antibody [NBP1-87311]

Simple Western: PHGDH Antibody [NBP1-87311] - Simple Western lane view shows a specific band for PHGDH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: PHGDH Antibody [NBP1-87311]

Simple Western: PHGDH Antibody [NBP1-87311]

Simple Western: PHGDH Antibody [NBP1-87311] - Electropherogram image(s) of corresponding Simple Western lane view. PHGDH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).
PHGDH Antibody

Western Blot: PHGDH Antibody [NBP1-87311] -

Knockdown of PNKP or TDP1 leads to increase in expression of PSAT1 and PHGDH. Western blot analysis of XRCC1, PHGDH and PSAT1 expression upon KD of PNKP (A) or TDP1 (B). beta -Actin served as a loading control. (C) TDP1 mRNA levels after KD of TDP1, quantified by qPCR and normalised to GAPDH.
PHGDH Antibody - BSA Free

Western Blot: PHGDH Antibody - BSA Free [NBP1-87311] -

Knockdown of PNKP or TDP1 leads to increase in expression of PSAT1 and PHGDH. Western blot analysis of XRCC1, PHGDH and PSAT1 expression upon KD of PNKP (A) or TDP1 (B). beta -Actin served as a loading control. (C) TDP1 mRNA levels after KD of TDP1, quantified by qPCR and normalised to GAPDH. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/25800737), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PHGDH Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 56 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHGDH

3-Phosphoglycerate dehydrogenase (PHGDH; EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.[supplied by OMIM]

Long Name

3-Phosphoglycerate Dehydrogenase

Alternate Names

3PGDH, PDGH3

Gene Symbol

PHGDH

Additional PHGDH Products

Product Documents for PHGDH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PHGDH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Redox Enzymes

Citations for PHGDH Antibody - BSA Free

Customer Reviews for PHGDH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHGDH Antibody - BSA Free and earn rewards!

Have you used PHGDH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PHGDH Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: We would like to know the concentration of this antibody for IHC.

    A: The concentration of our latest lot of NBP1-87311 is 0.2 mg/mL. We recommend using it at a dilution of 1:500-1:1000 for IHC.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies