Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1)

Novus Biologicals | Catalog # NBP3-16183

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5U6G1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Phospholipid Scramblase 1/PLSCR1 (NP_066928.1). MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1)

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183]

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183]

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183] - Western blot analysis of extracts of HT-29 cells, using Phospholipid Phospholipid Scramblase 1/PLSCR1 (PLSCR1) Rabbit mAb (NBP3-16183) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183]

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183]

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183] - Western blot analysis of extracts of Mouse lung, using Phospholipid Phospholipid Scramblase 1/PLSCR1 (PLSCR1) Rabbit mAb (NBP3-16183) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183]

Immunohistochemistry-Paraffin: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183]

Immunohistochemistry-Paraffin: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183] - Immunohistochemistry of paraffin-embedded human breast cancer using Phospholipid Phospholipid Scramblase 1/PLSCR1 (PLSCR1) Rabbit mAb (NBP3-16183) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1)

Immunocytochemistry/ Immunofluorescence: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183] -

Immunocytochemistry/ Immunofluorescence: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183] - Immunofluorescence analysis of C6 cells using Phospholipid Phospholipid Scramblase 1/PLSCR1 (PLSCR1) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Phospholipid Scramblase 1/PLSCR1

Scramblase 1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in theplasma membrane. May play a central role in the initiation of fibrin clot forma

Alternate Names

MMTRA1B, PLSCR1

Gene Symbol

PLSCR1

Additional Phospholipid Scramblase 1/PLSCR1 Products

Product Documents for Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1)

There are currently no reviews for this product. Be the first to review Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) and earn rewards!

Have you used Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...