PIDD Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03535

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PIDD Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human PIDD (NP_665893.2). MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDPQLLEATLAQL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PIDD Antibody - BSA Free

PIDD Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PIDD Antibody - BSA Free [PIDD] -

Immunocytochemistry/ Immunofluorescence: PIDD Antibody - BSA Free [PIDD] - Immunofluorescence analysis of HeLa cells using PIDD Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: PIDD Antibody - BSA Free [NBP3-03535]

Immunohistochemistry-Paraffin: PIDD Antibody - BSA Free [NBP3-03535]

Immunohistochemistry-Paraffin: LRDD Antibody [NBP3-03535] - Paraffin-embedded mouse brain using LRDD antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: PIDD Antibody - BSA Free [NBP3-03535]

Immunohistochemistry-Paraffin: PIDD Antibody - BSA Free [NBP3-03535]

Immunohistochemistry-Paraffin: LRDD Antibody [NBP3-03535] - Paraffin-embedded human lung cancer using LRDD antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: PIDD Antibody - BSA Free [NBP3-03535]

Immunohistochemistry-Paraffin: PIDD Antibody - BSA Free [NBP3-03535]

Immunohistochemistry-Paraffin: LRDD Antibody [NBP3-03535] - Paraffin-embedded rat brain using LRDD antibody at dilution of 1:100 (40x lens).

Applications for PIDD Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PIDD

The protein encoded by the LRDD gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain-containing protein (MADD), and thus may function as an adaptor protein in cell death-related signaling processes. The expression of the mouse counterpart of this gene has been found to be positively regulated by the tumor suppressor p53 and to induce cell apoptosis in response to DNA damage, which suggests a role for this gene as an effector of p53-dependent apoptosis. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. (provided by RefSeq)

Long Name

p53-Induced Protein With A Death Domain

Alternate Names

LRDD

Gene Symbol

PIDD1

Additional PIDD Products

Product Documents for PIDD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PIDD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIDD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIDD Antibody - BSA Free and earn rewards!

Have you used PIDD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies