Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human
Predicted:
Rat (91%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LTGLSLLPLSEKAARARQEELYSELQARETFEKTPVEVPVGGFKGRTVTVWELISSEYFTAEQRQELLRQFRTGKVTVEKVIKILIT
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Plectin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Plectin Antibody [NBP1-84020]
Immunocytochemistry/Immunofluorescence: Plectin Antibody [NBP1-84020] - Plectin antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody. Nuclei stained with DAPI (blue). Image from verified customer review.Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020]
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human liver shows no positivity in hepatocytes as expected.Immunocytochemistry/ Immunofluorescence: Plectin Antibody [NBP1-84020]
Immunocytochemistry/Immunofluorescence: Plectin Antibody [NBP1-84020] - Staining of human cell line U-2 OS shows localization to cytosol & intermediate filaments. Antibody staining is shown in green.Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020]
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human kidney, liver, placenta and skeletal muscle using Anti-Plectin antibody NBP1-84020 (A) shows similar protein distribution across tissues to independent antibody NBP1-84019 (B).Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020]
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.Immunohistochemistry-Paraffin: Plectin Antibody - BSA Free [NBP1-84020]
Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.Immunohistochemistry-Paraffin: Plectin Antibody - BSA Free [NBP1-84020]
Staining of human placenta shows strong membranous positivity in trophoblastic cells.Applications for Plectin Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 5 using NBP1-84020 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Plectin
Alternate Names
EBS1, HD1, Hemidesmosomal protein 1, LGMD2Q, PCNplectin 1, intermediate filament binding protein, 500kD, PLEC1b, PLEC1EBSO, plectin, plectin 1, intermediate filament binding protein 500kDa, plectin-1, PLTNepidermolysis bullosa simplex 1 (Ogna)
Gene Symbol
PLEC
Additional Plectin Products
Product Documents for Plectin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Plectin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Plectin Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used Plectin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Indirect ImmunofluorescenceSample Tested: Cell cultureSpecies: HumanVerified Customer | Posted 05/03/2022Plectrin antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody. Nuclei stained with DAPI (blue).
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...