PMP70 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38199

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PMP70 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PMP70 Antibody [NBP2-38199]

Immunocytochemistry/ Immunofluorescence: PMP70 Antibody [NBP2-38199]

Immunocytochemistry/Immunofluorescence: PMP70 Antibody [NBP2-38199] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining in human liver and skeletal muscle tissues using NBP2-38199 antibody. Corresponding ABCD3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining of human kidney, liver, skeletal muscle and testis using Anti-ABCD3 antibody NBP2-38199 (A) shows similar protein distribution across tissues to independent antibody NBP1-87258 (B).
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199]

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

Applications for PMP70 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PMP70

PMP70 is encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Alternate Names

70 kDa peroxisomal membrane protein, ABC43, ATP-binding cassette, sub-family D (ALD), member 3, peroxisomal membrane protein 1 (70kD, Zellweger syndrome), Peroxisomal membrane protein-1 (70kD), PMP70ATP-binding cassette sub-family D member 3, PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1)), ZWS2

Gene Symbol

ABCD3

UniProt

Additional PMP70 Products

Product Documents for PMP70 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PMP70 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PMP70 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PMP70 Antibody - BSA Free and earn rewards!

Have you used PMP70 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...