PNPO Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35861

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PNPO Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human PNPO (NP_060599.1).

Sequence:
MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PNPO Antibody - BSA Free

PNPO Antibody

Western Blot: PNPO Antibody [NBP3-35861] -

Western Blot: PNPO Antibody [NBP3-35861] - Western blot analysis of various lysates using PNPO Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
PNPO Antibody

Immunocytochemistry/ Immunofluorescence: PNPO Antibody [NBP3-35861] -

Immunocytochemistry/ Immunofluorescence: PNPO Antibody [NBP3-35861] - Immunofluorescence analysis of L929 cells using PNPO Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
PNPO Antibody

Immunocytochemistry/ Immunofluorescence: PNPO Antibody [NBP3-35861] -

Immunocytochemistry/ Immunofluorescence: PNPO Antibody [NBP3-35861] - Immunofluorescence analysis of U2OS cells using PNPO Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for PNPO Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PNPO

Vitamin B6, or pyridoxal 5-prime-phosphate (PLP), is critical for normal cellular function, and some cancer cells have notable differences in vitamin B6 metabolism compared to their normal counterparts. The rate-limiting enzyme in vitamin B6 synthesis is pyridoxine-5-prime-phosphate (PNP) oxidase (PNPO; EC 1.4.3.5).[supplied by OMIM]

Alternate Names

EC 1.4.3.5, FLJ10535, PDXPO, pyridoxal 5'-phosphate synthase, pyridoxamine 5'-phosphate oxidase, Pyridoxamine-phosphate oxidase, pyridoxine 5'-phosphate oxidase, pyridoxine-5'-phosphate oxidase

Gene Symbol

PNPO

Additional PNPO Products

Product Documents for PNPO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PNPO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PNPO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PNPO Antibody - BSA Free and earn rewards!

Have you used PNPO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies