POLR3E Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84621

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all POLR3E Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FVMWKFTQSRWVVRKEVATVTKLCAEDVKDFLEHMAVVRINKGWEFILPYDGEFIKKHPDVVQRQHMLWTGIQAKLEKVYNLVKETMPKKPDAQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for POLR3E Antibody - BSA Free

POLR3E Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: POLR3E Antibody - BSA Free [NBP1-84621]

Chromatin Immunoprecipitation-exo-Seq: POLR3E Antibody - BSA Free [NBP1-84621]

ChIP-Exo-Seq composite graph for Anti-POLR3E (NBP1-84621) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
POLR3E Antibody - BSA Free Western Blot: POLR3E Antibody - BSA Free [NBP1-84621]

Western Blot: POLR3E Antibody - BSA Free [NBP1-84621]

Analysis in human cell line K562.
Immunocytochemistry/ Immunofluorescence: POLR3E Antibody [NBP1-84621]

Immunocytochemistry/ Immunofluorescence: POLR3E Antibody [NBP1-84621]

Immunocytochemistry/Immunofluorescence: POLR3E Antibody [NBP1-84621] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621]

Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621]

Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621] - Staining of human Small intestine shows moderate nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621]

Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621]

Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.
Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621]

Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621]

Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621] - Staining of human Skin shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621]

Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621]

Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621] - Staining of human Testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Applications for POLR3E Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POLR3E

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Essential for efficient transcription from both the type 2 VAI and type 3 U6 RNA polymerase III promoters. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway

Alternate Names

DNA-directed RNA polymerase III 80 kDa polypeptide, DNA-directed RNA polymerase III subunit RPC5, FLJ10509, KIAA1452, polymerase (RNA) III (DNA directed) polypeptide E (80kD), RNA polymerase III 80 kDa subunit RPC5, RNA polymerase III subunit C5, RPC5, SIN

Gene Symbol

POLR3E

Additional POLR3E Products

Product Documents for POLR3E Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for POLR3E Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for POLR3E Antibody - BSA Free

Customer Reviews for POLR3E Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POLR3E Antibody - BSA Free and earn rewards!

Have you used POLR3E Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies