POLR3H Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13787

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: GFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for POLR3H Antibody - BSA Free

Western Blot: POLR3H Antibody [NBP2-13787]

Western Blot: POLR3H Antibody [NBP2-13787]

Western Blot: POLR3H Antibody [NBP2-13787] - Analysis in control (vector only transfected HEK293T lysate) and POLR3H over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: POLR3H Antibody [NBP2-13787]

Immunocytochemistry/ Immunofluorescence: POLR3H Antibody [NBP2-13787]

Immunocytochemistry/Immunofluorescence: POLR3H Antibody [NBP2-13787] - Staining of human cell line A-431 shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: POLR3H Antibody [NBP2-13787]

Immunohistochemistry-Paraffin: POLR3H Antibody [NBP2-13787]

Immunohistochemistry-Paraffin: POLR3H Antibody [NBP2-13787] - Staining of human stomach, lower shows moderate nuclear positivity in glandular cells.
POLR3H Antibody - BSA Free Chromatin Immunoprecipitation ChIP: POLR3H Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: POLR3H Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-POLR3H tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for POLR3H Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POLR3H

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleosidetriphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Actsas nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves astemplate for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encodedRNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway

Alternate Names

DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide, DNA-directed RNA polymerase III subunit H, DNA-directed RNA polymerase III subunit RPC8, KIAA1665MGC29654, MGC111097, polymerase (RNA) III (DNA directed) polypeptide H (22.9kD), RNA nucleotidyltransferase (DNA-directed), RNA polymerase III subunit 22.9 kDa subunit, RNA polymerase III subunit C8, RNA polymerase III subunit RPC8, RPC8RPC22.9

Gene Symbol

POLR3H

Additional POLR3H Products

Product Documents for POLR3H Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POLR3H Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POLR3H Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POLR3H Antibody - BSA Free and earn rewards!

Have you used POLR3H Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...