PRAS40 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55261

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to AKT1S1(AKT1 substrate 1 (proline-rich)) The peptide sequence was selected from the C terminal of AKT1S1. Peptide sequence KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PRAS40 Antibody - BSA Free

Western Blot: PRAS40 Antibody [NBP1-55261]

Western Blot: PRAS40 Antibody [NBP1-55261]

Western Blot: PRAS40 Antibody [NBP1-55261] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: 293T cell lysate
Immunohistochemistry: PRAS40 Antibody [NBP1-55261]

Immunohistochemistry: PRAS40 Antibody [NBP1-55261]

Immunohistochemistry: PRAS40 Antibody [NBP1-55261] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic in endothelial cells in blood vessels Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Applications for PRAS40 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRAS40

AKT1S1 may play an important role in phosphatidylinositol 3-kinase (PI3K)-AKT1 survival signaling. It is the substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. Its role in survival signaling pathways may be modulated by oxidative stress. AKT1S1 may also play a role in nerve growth factor-mediated neuroprotection.AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM].

Long Name

40 kDa Proline-rich Akt1 Substrate

Alternate Names

AKT1S1, Lobe

Gene Symbol

AKT1S1

UniProt

Additional PRAS40 Products

Product Documents for PRAS40 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PRAS40 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PRAS40 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRAS40 Antibody - BSA Free and earn rewards!

Have you used PRAS40 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies