Proapoptotic Caspase Adaptor Protein Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55874

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Proapoptotic Caspase Adaptor Protein Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Proapoptotic Caspase Adaptor Protein Antibody - BSA Free

Western Blot: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Western Blot: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Western Blot: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Analysis using Anti-MZB1 antibody NBP2-55874 (A) shows similar pattern to independent antibody NBP1-92287 (B).
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Staining of human liver, lymph node, placenta and small intestine using Anti-MZB1 antibody NBP2-55874 (A) shows similar protein distribution across tissues to independent antibody NBP1-92287 (B).
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Analysis in human lymph node and liver tissues using NBP2-55874 antibody. Corresponding MZB1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of lymphoid cells.
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874]

Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Applications for Proapoptotic Caspase Adaptor Protein Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proapoptotic Caspase Adaptor Protein

Proapoptotic Caspase Adaptor Protein may be involved in regulation of apoptosis

Alternate Names

caspase-2 binding protein, FLJ32987, HSPC190, marginal zone B and B1 cell-specific protein, MGC29506, PACAP, pERp1, plasma cell-induced ER protein 1, plasma cell-induced resident endoplasmic reticulum protein, Plasma cell-induced resident ER protein, Proapoptotic caspase adapter protein, proapoptotic caspase adaptor protein

Gene Symbol

MZB1

Additional Proapoptotic Caspase Adaptor Protein Products

Product Documents for Proapoptotic Caspase Adaptor Protein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Proapoptotic Caspase Adaptor Protein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Proapoptotic Caspase Adaptor Protein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Proapoptotic Caspase Adaptor Protein Antibody - BSA Free and earn rewards!

Have you used Proapoptotic Caspase Adaptor Protein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies