Profilin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87426

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Profilin 2 Antibody - BSA Free

Western Blot: Profilin 2 Antibody [NBP1-87426]

Western Blot: Profilin 2 Antibody [NBP1-87426]

Western Blot: Profilin 2 Antibody [NBP1-87426] - Analysis in human cell lines A-431 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Western Blot: Profilin 2 Antibody [NBP1-87426]

Western Blot: Profilin 2 Antibody [NBP1-87426]

Western Blot: Profilin 2 Antibody [NBP1-87426] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: Profilin 2 Antibody [NBP1-87426]

Western Blot: Profilin 2 Antibody [NBP1-87426]

Western Blot: Profilin 2 Antibody [NBP1-87426] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Profilin 2 Antibody - BSA Free Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426]

Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426]

Staining of human skin shows low expression as expected.
Profilin 2 Antibody - BSA Free Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426]

Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426]

Analysis in human cerebral cortex and skin tissues.
Profilin 2 Antibody - BSA Free Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426]

Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426]

Staining of human cerebral cortex shows high expression.

Applications for Profilin 2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 3 using NBP1-87426 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Profilin 2

Profilin 2 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals by binding to actin (1:1 ratio) and so affecting the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. Highly expressed in skeletal muscle, kidney and brain and less strongly in placenta, heart, liver and lung.

Alternate Names

D3S1319E, PFL, profilin 2, Profilin II, profilin-2

Gene Symbol

PFN2

Additional Profilin 2 Products

Product Documents for Profilin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Profilin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Profilin 2 Antibody - BSA Free

Customer Reviews for Profilin 2 Antibody - BSA Free (1)

3 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
100%
2 Stars
0%
1 Stars
0%

Have you used Profilin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • Profilin 2 Antibody
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: Mouse brain
    Species: Mouse
    Verified Customer | Posted 01/10/2019
    PfN2 used to stain neuronal dendrites and dendritic spines in normal pubertal and genetic modified pubertal mouse brain sections. Scale 2.5 micrometers
    Dilution of 1:50
    Profilin 2 Antibody - BSA Free NBP1-87426

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...