Prohibitin 2 Antibody (8I10B1)

Novus Biologicals | Catalog # NBP3-16766

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8I10B1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Prohibitin 2 (Prohibitin 2) (Q99623). QMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Prohibitin 2 Antibody (8I10B1)

Western Blot: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Western Blot: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Western Blot: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Western blot analysis of extracts of various cell lines, using Prohibitin 2 (Prohibitin 2) Rabbit mAb (NBP3-16766) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Immunofluorescence analysis of U-2 OS cells using Prohibitin 2 (Prohibitin 2) Rabbit mAb (NBP3-16766) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunohistochemistry-Paraffin: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunohistochemistry-Paraffin: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Immunohistochemistry of paraffin-embedded human colon carcinoma using Prohibitin 2 (Prohibitin 2) Rabbit mAb (NBP3-16766) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Immunofluorescence analysis of NIH-3T3 cells using Prohibitin 2 (Prohibitin 2) Rabbit mAb (NBP3-16766) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunoprecipitation: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunoprecipitation: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Immunoprecipitation analysis of 300ug extracts of SKOV3 cells using 3ug Prohibitin 2 antibody (NBP3-16766). Western blot was performed from the immunoprecipitate using Prohibitin 2 antibody (NBP3-16766) at a dilition of 1:1000.
Prohibitin 2 Antibody (8I10B1)

Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] -

Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Confocal imaging of NIH/3T3 cells using Prohibitin 2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Prohibitin 2 Antibody (8I10B1)

Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] -

Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Confocal imaging of U-2 OS cells using Prohibitin 2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for Prohibitin 2 Antibody (8I10B1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:3000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Prohibitin 2

REA, or repressor of estrogen receptor activity, (also known as BAP37, or B-cell receptor-associated protein) is a 37 kD erythrocyte band 7 integral membrane protein that contains an SPFH domain. It is located in the inner mitochondrial membrane that selectively potentiates the inhibitory effectiveness of antiestrogen-occupied ER. REA plays a possible role in cell aging and acts as a mitochondrial protein chaperone. This protein has been shown to interact with the estrogen receptor, prohibitin, and IgM.

Alternate Names

BAP, Bap37, BCAP37, D-Prohibitin, p22, PHB2, PNAS-141, REA

Gene Symbol

PHB2

Additional Prohibitin 2 Products

Product Documents for Prohibitin 2 Antibody (8I10B1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Prohibitin 2 Antibody (8I10B1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Prohibitin 2 Antibody (8I10B1)

There are currently no reviews for this product. Be the first to review Prohibitin 2 Antibody (8I10B1) and earn rewards!

Have you used Prohibitin 2 Antibody (8I10B1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies