Proteasome 19S S7 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87797
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Proteasome 19S S7 Antibody - BSA Free
Western Blot: Proteasome 19S S7 Antibody [NBP1-87797]
Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797]
Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.Simple Western: Proteasome 19S S7 Antibody [NBP1-87797]
Simple Western: Proteasome 19S S7 Antibody [NBP1-87797] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this Proteasome 19S S7 antibody. Burn-out of the major peak is beginning at 0.5 mg/mL. Simple Western image submitted by a verified customer review.Applications for Proteasome 19S S7 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Simple Western
1:25
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Proteasome 19S S7 antibody validated for Simple Western from a verified customer review.
See Simple Western Antibody Database for Simple Western validation: Tested in Mouse whole-spleen lysates, separated by Size, antibody dilution of 1:25
See Simple Western Antibody Database for Simple Western validation: Tested in Mouse whole-spleen lysates, separated by Size, antibody dilution of 1:25
Reviewed Applications
Read 2 reviews rated 4.5 using NBP1-87797 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Proteasome 19S S7
Alternate Names
26S protease regulatory subunit 7, 26S proteasome AAA-ATPase subunit RPT1, MGC3004, MSS1ATPase, 2, proteasome (prosome, macropain) 26S subunit, ATPase, 2, Protein MSS1, putative protein product of Nbla10058
Gene Symbol
PSMC2
Additional Proteasome 19S S7 Products
Product Documents for Proteasome 19S S7 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Proteasome 19S S7 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Proteasome 19S S7 Antibody - BSA Free (2)
4.5 out of 5
2 Customer Ratings
Have you used Proteasome 19S S7 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
2 of
2 reviews
Showing All
Filter By:
-
Application: Simple WesternSample Tested: Mouse Spleen LysateSpecies: MouseVerified Customer | Posted 08/23/2019Whole-spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this antibody. (Burn-out of the major peak is beginning at 0.5 mg/mL.)
-
Application: Western BlotSample Tested: HEK 293 cell lysate20 ugSpecies: HumanVerified Customer | Posted 08/20/2015
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...