Proteasome 20S alpha 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86838

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Proteasome 20S alpha 5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Proteasome 20S alpha 5 Antibody [NBP1-86838]

Immunocytochemistry/ Immunofluorescence: Proteasome 20S alpha 5 Antibody [NBP1-86838]

Immunocytochemistry/Immunofluorescence: Proteasome 20S alpha 5 Antibody [NBP1-86838] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Proteasome 20S alpha 5 Antibody [NBP1-86838]

Immunohistochemistry-Paraffin: Proteasome 20S alpha 5 Antibody [NBP1-86838]

Immunohistochemistry-Paraffin: Proteasome 20S alpha 5 Antibody [NBP1-86838] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in seminiferous duct cells.
Proteasome 20S alpha 5 Antibody - BSA Free Western Blot: Proteasome 20S alpha 5 Antibody - BSA Free [NBP1-86838]

Western Blot: Proteasome 20S alpha 5 Antibody - BSA Free [NBP1-86838]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Applications for Proteasome 20S alpha 5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF fixation permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proteasome 20S alpha 5

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signaling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Others are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. An enzymatic cascade is responsible for the attachment of multiple ubiquitin molecules to lysine residues of proteins targeted for degradation. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis, Angelman's syndrome, and Liddle syndrome.

Long Name

Proteasome subunit alpha type-5

Alternate Names

PSMA5

Gene Symbol

PSMA5

Additional Proteasome 20S alpha 5 Products

Product Documents for Proteasome 20S alpha 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Proteasome 20S alpha 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Proteasome 20S alpha 5 Antibody - BSA Free

Customer Reviews for Proteasome 20S alpha 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Proteasome 20S alpha 5 Antibody - BSA Free and earn rewards!

Have you used Proteasome 20S alpha 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...