Proteasome 20S beta 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33380

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Proteasome 20S beta 3 Antibody - BSA Free

Western Blot: Proteasome 20S beta 3 Antibody [NBP2-33380]

Western Blot: Proteasome 20S beta 3 Antibody [NBP2-33380]

Western Blot: Proteasome 20S beta 3 Antibody [NBP2-33380] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: Proteasome 20S beta 3 Antibody [NBP2-33380]

Immunocytochemistry/ Immunofluorescence: Proteasome 20S beta 3 Antibody [NBP2-33380]

Immunocytochemistry/Immunofluorescence: Proteasome 20S beta 3 Antibody [NBP2-33380] - Staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry: Proteasome 20S beta 3 Antibody [NBP2-33380]

Immunohistochemistry: Proteasome 20S beta 3 Antibody [NBP2-33380]

Immunohistochemistry: Proteasome 20S beta 3 Antibody [NBP2-33380] - Immunohistochemical staining of human breast shows strong cytoplasmic positivity in glandular cells.

Applications for Proteasome 20S beta 3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proteasome 20S beta 3

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Pseudogenes have been identified on chromosomes 2 and 12.

Long Name

Proteasome subunit beta type-3

Alternate Names

Proteasome chain 13, PSMB3

Gene Symbol

PSMB3

UniProt

Additional Proteasome 20S beta 3 Products

Product Documents for Proteasome 20S beta 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Proteasome 20S beta 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Proteasome 20S beta 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Proteasome 20S beta 3 Antibody - BSA Free and earn rewards!

Have you used Proteasome 20S beta 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...