Proteasome 20S beta2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92294

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Proteasome 20S beta2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Proteasome 20S beta2 Antibody - BSA Free

Western Blot: Proteasome 20S beta2 Antibody [NBP1-92294]

Western Blot: Proteasome 20S beta2 Antibody [NBP1-92294]

Western Blot: Proteasome 20S beta2 Antibody [NBP1-92294] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: Proteasome 20S beta2 Antibody [NBP1-92294]

Immunocytochemistry/ Immunofluorescence: Proteasome 20S beta2 Antibody [NBP1-92294]

Immunocytochemistry/Immunofluorescence: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294]

Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294]

Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human colon shows strong cytoplasmic positivity in glandular cells
Proteasome 20S beta2 Antibody - BSA Free Western Blot: Proteasome 20S beta2 Antibody - BSA Free [NBP1-92294]

Western Blot: Proteasome 20S beta2 Antibody - BSA Free [NBP1-92294]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
Proteasome 20S beta2 Antibody - BSA Free Immunohistochemistry: Proteasome 20S beta2 Antibody - BSA Free [NBP1-92294]

Immunohistochemistry: Proteasome 20S beta2 Antibody - BSA Free [NBP1-92294]

Staining of human kidney shows moderate to strong nuclear and cytoplasmic positivity in cells in tubules.
Proteasome 20S beta2 Antibody - BSA Free Immunohistochemistry: Proteasome 20S beta2 Antibody - BSA Free [NBP1-92294]

Immunohistochemistry: Proteasome 20S beta2 Antibody - BSA Free [NBP1-92294]

Staining of human placenta shows moderate to strong nuclear and cytoplasmic positivity in trophoblastic cells.
Proteasome 20S beta2 Antibody - BSA Free Immunohistochemistry: Proteasome 20S beta2 Antibody - BSA Free [NBP1-92294]

Immunohistochemistry: Proteasome 20S beta2 Antibody - BSA Free [NBP1-92294]

Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.

Applications for Proteasome 20S beta2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proteasome 20S beta2

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Long Name

Proteasome subunit beta type-2

Alternate Names

PSMB2

Gene Symbol

PSMB2

Additional Proteasome 20S beta2 Products

Product Documents for Proteasome 20S beta2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Proteasome 20S beta2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Proteasome 20S beta2 Antibody - BSA Free

Customer Reviews for Proteasome 20S beta2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Proteasome 20S beta2 Antibody - BSA Free and earn rewards!

Have you used Proteasome 20S beta2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies