Proteasome 20S beta2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38161

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human Proteasome 20S beta2 (NP_002785.1).

Sequence:
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Proteasome 20S beta2 Antibody - BSA Free

Proteasome 20S beta2 Antibody

Immunoprecipitation: Proteasome 20S beta2 Antibody [NBP3-38161] -

Immunoprecipitation: Proteasome 20S beta2 Antibody [NBP3-38161] - Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug Proteasome 20S beta2 antibody. Western blot was performed from the immunoprecipitate using Proteasome 20S beta2 antibody at a dilution of 1:1000.
Proteasome 20S beta2 Antibody

Western Blot: Proteasome 20S beta2 Antibody [NBP3-38161] -

Western Blot: Proteasome 20S beta2 Antibody [NBP3-38161] - Western blot analysis of various lysates using Proteasome 20S beta2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Proteasome 20S beta2 Antibody

Western Blot: Proteasome 20S beta2 Antibody [NBP3-38161] -

Western Blot: Proteasome 20S beta2 Antibody [NBP3-38161] - Western blot analysis of various lysates using Proteasome 20S beta2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
Proteasome 20S beta2 Antibody

Immunohistochemistry: Proteasome 20S beta2 Antibody [NBP3-38161] -

Immunohistochemistry: Proteasome 20S beta2 Antibody [NBP3-38161] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Proteasome 20S beta2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Proteasome 20S beta2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Proteasome 20S beta2

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Long Name

Proteasome subunit beta type-2

Alternate Names

PSMB2

Gene Symbol

PSMB2

Additional Proteasome 20S beta2 Products

Product Documents for Proteasome 20S beta2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Proteasome 20S beta2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Proteasome 20S beta2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Proteasome 20S beta2 Antibody - BSA Free and earn rewards!

Have you used Proteasome 20S beta2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...