Proteasome beta 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89713

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Proteasome beta 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713] - Staining of human colon, kidney, liver and testis using Anti-PSMB1 antibody NBP1-89713 (A) shows similar protein distribution across tissues to independent antibody NBP1-89714 (B).
Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713] - Staining of human testis shows moderate to strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713] - Staining of human kidney shows moderate to strong cytoplasmic and nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.
Proteasome beta 1 Antibody - BSA Free Western Blot: Proteasome beta 1 Antibody - BSA Free [NBP1-89713]

Western Blot: Proteasome beta 1 Antibody - BSA Free [NBP1-89713]

Analysis using Anti-PSMB1 antibody NBP1-89713 (A) shows similar pattern to independent antibody NBP1-89714 (B).

Applications for Proteasome beta 1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proteasome beta 1

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is tightly linked to the TBP (TATA-binding protein) gene in human and in mouse, and is transcribed in the opposite orientation in both species. [provided by RefSeq]

Long Name

Proteasome subunit beta type-1

Alternate Names

PSC5, PSMB1

Entrez Gene IDs

5689 (Human)

Gene Symbol

PSMB1

UniProt

Additional Proteasome beta 1 Products

Product Documents for Proteasome beta 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Proteasome beta 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Proteasome beta 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Proteasome beta 1 Antibody - BSA Free and earn rewards!

Have you used Proteasome beta 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...