PSF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92300

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSF3 Antibody - BSA Free

Western Blot: PSF3 Antibody [NBP1-92300]

Western Blot: PSF3 Antibody [NBP1-92300]

Western Blot: PSF3 Antibody [NBP1-92300] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: PSF3 Antibody [NBP1-92300]

Immunocytochemistry/ Immunofluorescence: PSF3 Antibody [NBP1-92300]

Immunocytochemistry/Immunofluorescence: PSF3 Antibody [NBP1-92300] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Western Blot: PSF3 Antibody [NBP1-92300]

Western Blot: PSF3 Antibody [NBP1-92300]

Western Blot: PSF3 Antibody [NBP1-92300] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
PSF3 Antibody - BSA Free Western Blot: PSF3 Antibody - BSA Free [NBP1-92300]

Western Blot: PSF3 Antibody - BSA Free [NBP1-92300]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
PSF3 Antibody - BSA Free Western Blot: PSF3 Antibody - BSA Free [NBP1-92300]

Western Blot: PSF3 Antibody - BSA Free [NBP1-92300]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
PSF3 Antibody - BSA Free Immunohistochemistry-Paraffin: PSF3 Antibody [NBP1-92300]

Immunohistochemistry-Paraffin: PSF3 Antibody [NBP1-92300]

Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Applications for PSF3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSF3

PSF3, also known as DNA replication complex GINS protein PSF3, has a 138 amino acid long isoform that is 25 kDa and a short 138 amino acid that is approx. 16 kDa, is located in the nucleus and plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. Studies on this protein have shown a relationship with colon cancer and long QT syndrome. This protein has been studied in DNA replication where it interacts with PSMA4, WDHD1, PSMA6 and MCM6.

Alternate Names

DNA replication complex GINS protein PSF3, GINS complex subunit 3, GINS complex subunit 3 (Psf3 homolog), PSF3FLJ13912

Gene Symbol

GINS3

Additional PSF3 Products

Product Documents for PSF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSF3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSF3 Antibody - BSA Free and earn rewards!

Have you used PSF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...