PSMD14 Antibody (5V0H3)
Novus Biologicals | Catalog # NBP3-16837
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 5V0H3 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 112-210 of human PSMD14 (O00487). YHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for PSMD14 Antibody (5V0H3)
Western Blot: PSMD14 Antibody (5V0H3) [NBP3-16837] -
Western Blot: PSMD14 Antibody (5V0H3) [NBP3-16837] - Western blot analysis of various lysates using PSMD14 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: PSMD14 Antibody (5V0H3) [NBP3-16837] -
Immunocytochemistry/ Immunofluorescence: PSMD14 Antibody (5V0H3) [NBP3-16837] - Confocal imaging of U-2OS cells using PSMD14 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 40x.Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] -
Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] -
Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] -
Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] -
Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] -
Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] -
Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] -
Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Applications for PSMD14 Antibody (5V0H3)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: PSMD14
Alternate Names
EC 3.1.2.15, EC 3.4.19.-, pad1, POH126S proteasome non-ATPase regulatory subunit 14,26S proteasome regulatory subunit RPN11, proteasome (prosome, macropain) 26S subunit, non-ATPase, 14, Rpn11, RPN11,26S proteasome-associated PAD1 homolog 1
Gene Symbol
PSMD14
Additional PSMD14 Products
Product Documents for PSMD14 Antibody (5V0H3)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PSMD14 Antibody (5V0H3)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PSMD14 Antibody (5V0H3)
There are currently no reviews for this product. Be the first to review PSMD14 Antibody (5V0H3) and earn rewards!
Have you used PSMD14 Antibody (5V0H3)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...