PSMD7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38780

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PSMD7 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: IVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSMD7 Antibody - BSA Free

Western Blot: PSMD7 Antibody [NBP2-38780]

Western Blot: PSMD7 Antibody [NBP2-38780]

Western Blot: PSMD7 Antibody [NBP2-38780] - Analysis using Anti-PSMD7 antibody NBP2-38780 (A) shows similar pattern to independent antibody NBP2-38612 (B).
Immunocytochemistry/ Immunofluorescence: PSMD7 Antibody [NBP2-38780]

Immunocytochemistry/ Immunofluorescence: PSMD7 Antibody [NBP2-38780]

Immunocytochemistry/Immunofluorescence: PSMD7 Antibody [NBP2-38780] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human kidney.
Immunohistochemistry: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry: PSMD7 Antibody [NBP2-38780] - Staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human cerebral cortex, colon, kidney and testis using Anti-PSMD7 antibody NBP2-38780 (A) shows similar protein distribution across tissues to independent antibody NBP2-38612 (B).
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human testis.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780]

Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human colon.

Applications for PSMD7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMD7

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signaling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Others are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum.

Alternate Names

26S proteasome non-ATPase regulatory subunit 7, 26S proteasome regulatory subunit RPN8, Moloney leukemia virus-34 proviral integration, Mov34 homolog, Mov34 protein homolog, MOV3426S proteasome regulatory subunit S12, MOV34L, P40, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 (Mov34 homolog), Proteasome subunit p40, Rpn8, S12

Gene Symbol

PSMD7

UniProt

P51665 (Human)

Additional PSMD7 Products

Product Documents for PSMD7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PSMD7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSMD7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSMD7 Antibody - BSA Free and earn rewards!

Have you used PSMD7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies