PTBP2 Antibody (10S9P6)

Novus Biologicals | Catalog # NBP3-16756

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10S9P6 expressed in HEK293
View all PTBP2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTBP2 (Q9UKA9). MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PTBP2 Antibody (10S9P6)

Western Blot: PTBP2 Antibody (10S9P6) [NBP3-16756]

Western Blot: PTBP2 Antibody (10S9P6) [NBP3-16756]

Western Blot: PTBP2 Antibody (10S9P6) [NBP3-16756] - Western blot analysis of extracts of various cell lines, using PTBP2 Rabbit mAb (NBP3-16756) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
PTBP2 Antibody (10S9P6)

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [NBP3-16756] - Confocal imaging of U-2 OS cells using PTBP2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
PTBP2 Antibody (10S9P6)

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
PTBP2 Antibody (10S9P6)

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
PTBP2 Antibody (10S9P6)

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
PTBP2 Antibody (10S9P6)

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
PTBP2 Antibody (10S9P6)

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [NBP3-16756] - Confocal imaging of A549 cells using PTBP2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
PTBP2 Antibody (10S9P6)

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [NBP3-16756] - Confocal imaging of paraffin-embedded Mouse brain using PTBP2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
PTBP2 Antibody (10S9P6)

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
PTBP2 Antibody (10S9P6)

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
PTBP2 Antibody (10S9P6)

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
PTBP2 Antibody (10S9P6)

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
PTBP2 Antibody (10S9P6)

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
PTBP2 Antibody (10S9P6)

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] -

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for PTBP2 Antibody (10S9P6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PTBP2

PTBP2 is encoded by this gene binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrimidine tract binding protein but it is expressed primarily in the brain.

Alternate Names

brPTB, FLJ34897, neural polypyrimidine tract binding protein, Neural polypyrimidine tract-binding protein, Neurally-enriched homolog of PTB, nPTB, nPTB6, nPTB7, nPTB8, polypyrimidine tract binding protein 2, polypyrimidine tract-binding protein 2, PTB-like protein, PTBPTBLPnPTB5, splicing regulator

Gene Symbol

PTBP2

Additional PTBP2 Products

Product Documents for PTBP2 Antibody (10S9P6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PTBP2 Antibody (10S9P6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PTBP2 Antibody (10S9P6)

There are currently no reviews for this product. Be the first to review PTBP2 Antibody (10S9P6) and earn rewards!

Have you used PTBP2 Antibody (10S9P6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies