PYGL Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38314

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PYGL Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 690-847 of human PYGL (NP_002854.3).

Sequence:
IGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNESNKVNGN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PYGL Antibody - BSA Free

PYGL Antibody

Immunocytochemistry/ Immunofluorescence: PYGL Antibody [NBP3-38314] -

Immunocytochemistry/ Immunofluorescence: PYGL Antibody [NBP3-38314] - Immunofluorescence analysis of HeLa cells using PYGL Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PYGL Antibody

Immunoprecipitation: PYGL Antibody [NBP3-38314] -

Immunoprecipitation: PYGL Antibody [NBP3-38314] - Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug PYGL antibody. Western blot was performed from the immunoprecipitate using PYGL antibody at a dilution of 1:1000.
PYGL Antibody

Western Blot: PYGL Antibody [NBP3-38314] -

Western Blot: PYGL Antibody [NBP3-38314] - Western blot analysis of various lysates using PYGL Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
PYGL Antibody

Immunohistochemistry: PYGL Antibody [NBP3-38314] -

Immunohistochemistry: PYGL Antibody [NBP3-38314] - Immunohistochemistry analysis of paraffin-embedded Human liver using PYGL Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PYGL Antibody

Immunocytochemistry/ Immunofluorescence: PYGL Antibody [NBP3-38314] -

Immunocytochemistry/ Immunofluorescence: PYGL Antibody [NBP3-38314] - Immunofluorescence analysis of HepG2 cells using PYGL Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for PYGL Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PYGL

Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties. Activity of phosphorylase is controlled both by allosteric means (through the noncovalent binding of metabolites) and by covalent modification. Thus AMP allosterically activates, whereas ATP, ADP, and glucose 6 phosphate allosterically inhibit, phosphorylase B.

Long Name

Glycogen phosphorylase, liver form

Alternate Names

EC 2.4.1.1, glycogen phosphorylase, liver form, GSD6, phosphorylase, glycogen, liver, phosphorylase, glycogen; liver

Gene Symbol

PYGL

Additional PYGL Products

Product Documents for PYGL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PYGL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PYGL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PYGL Antibody - BSA Free and earn rewards!

Have you used PYGL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies