Pyridoxal Kinase/PDXK Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88284

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Pyridoxal Kinase/PDXK Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Pyridoxal Kinase/PDXK Antibody - BSA Free

Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284]

Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284]

Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding PDXK RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284]

Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284]

Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284]

Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284]

Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284] - Staining of human skeletal muscle shows very weak positivity in a subset of myocytes.
Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284]

Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284]

Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284]

Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284]

Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Pyridoxal Kinase/PDXK Antibody - BSA Free Western Blot: Pyridoxal Kinase/PDXK Antibody - BSA Free [NBP1-88284]

Western Blot: Pyridoxal Kinase/PDXK Antibody - BSA Free [NBP1-88284]

Analysis in human cell line CAPAN-2.

Applications for Pyridoxal Kinase/PDXK Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000-1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Pyridoxal Kinase/PDXK

Pyridoxal Kinase/PDXK is encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Alternate Names

C21orf124, C21orf97, HEL-S-1a, PDXK, PKH, PNK, Vitamin B6 Kinase

Gene Symbol

PDXK

Additional Pyridoxal Kinase/PDXK Products

Product Documents for Pyridoxal Kinase/PDXK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Pyridoxal Kinase/PDXK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Intracellular Kinases

Customer Reviews for Pyridoxal Kinase/PDXK Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pyridoxal Kinase/PDXK Antibody - BSA Free and earn rewards!

Have you used Pyridoxal Kinase/PDXK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies